BLASTX nr result
ID: Cnidium21_contig00021432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021432 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274315.1| PREDICTED: rae1-like protein At1g80670 [Viti... 66 3e-09 gb|ABG29731.1| RNA export 1 [Nicotiana benthamiana] 65 6e-09 gb|AFP49337.1| RNA export protein, partial [Olea europaea] 65 8e-09 ref|XP_002304718.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_002527320.1| plant poly(A)+ RNA export protein, putative ... 64 1e-08 >ref|XP_002274315.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|297743618|emb|CBI36485.3| unnamed protein product [Vitis vinifera] Length = 345 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 266 VCYDWSKGAENHNPSTAKTNIFLHVPQESEV 174 VCYDWSKGAENHNPSTAK +IFLH+PQESEV Sbjct: 304 VCYDWSKGAENHNPSTAKNHIFLHLPQESEV 334 >gb|ABG29731.1| RNA export 1 [Nicotiana benthamiana] Length = 347 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 266 VCYDWSKGAENHNPSTAKTNIFLHVPQESEV 174 VCYDWSKGAENHNPSTAKT I+LH PQESEV Sbjct: 305 VCYDWSKGAENHNPSTAKTYIYLHFPQESEV 335 >gb|AFP49337.1| RNA export protein, partial [Olea europaea] Length = 61 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 266 VCYDWSKGAENHNPSTAKTNIFLHVPQESEV 174 VCYDWSKGAENHNP+TAKT I+LH+PQESEV Sbjct: 19 VCYDWSKGAENHNPATAKTYIYLHLPQESEV 49 >ref|XP_002304718.1| predicted protein [Populus trichocarpa] gi|222842150|gb|EEE79697.1| predicted protein [Populus trichocarpa] Length = 349 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 266 VCYDWSKGAENHNPSTAKTNIFLHVPQESEV 174 VCYDWSKGAENHNP+TAKT I+LH+PQESEV Sbjct: 307 VCYDWSKGAENHNPATAKTYIYLHLPQESEV 337 >ref|XP_002527320.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] gi|223533320|gb|EEF35072.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] Length = 349 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 266 VCYDWSKGAENHNPSTAKTNIFLHVPQESEV 174 VCYDWSKGAENHNP TAKT I+LH+PQESEV Sbjct: 307 VCYDWSKGAENHNPQTAKTYIYLHLPQESEV 337