BLASTX nr result
ID: Cnidium21_contig00021354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021354 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171897.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 109 3e-22 ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 109 3e-22 gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzym... 105 3e-21 gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thal... 105 3e-21 ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana... 105 3e-21 >ref|XP_004171897.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis sativus] Length = 681 Score = 109 bits (272), Expect = 3e-22 Identities = 52/88 (59%), Positives = 70/88 (79%), Gaps = 4/88 (4%) Frame = -1 Query: 252 DMVYKLIIKSELFVPKDRGGKVFVSPDYNQSMEQQREMTMRRIQYLVRHGVFDGFLTTDE 73 D ++ L+++S+LF P GG+VFVSPDYNQSM+QQREMTM+RI+YL+ +GVF G+LT + Sbjct: 61 DWIFGLMVQSKLFNPLQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFKGWLTDNG 120 Query: 72 L----RSFAIADAVGAYDHSLGIKLGVH 1 + R FA+ +A+G YDHSL IKLGVH Sbjct: 121 IEAAWRKFALFEAIGIYDHSLAIKLGVH 148 >ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis sativus] Length = 681 Score = 109 bits (272), Expect = 3e-22 Identities = 52/88 (59%), Positives = 70/88 (79%), Gaps = 4/88 (4%) Frame = -1 Query: 252 DMVYKLIIKSELFVPKDRGGKVFVSPDYNQSMEQQREMTMRRIQYLVRHGVFDGFLTTDE 73 D ++ L+++S+LF P GG+VFVSPDYNQSM+QQREMTM+RI+YL+ +GVF G+LT + Sbjct: 61 DWIFGLMVQSKLFNPLQSGGRVFVSPDYNQSMQQQREMTMKRIEYLLDNGVFKGWLTDNG 120 Query: 72 L----RSFAIADAVGAYDHSLGIKLGVH 1 + R FA+ +A+G YDHSL IKLGVH Sbjct: 121 IEAAWRKFALFEAIGIYDHSLAIKLGVH 148 >gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzyme A oxidase I precursor from Candida tropicalis gb|M12161 [Arabidopsis thaliana] Length = 305 Score = 105 bits (263), Expect = 3e-21 Identities = 51/88 (57%), Positives = 67/88 (76%), Gaps = 4/88 (4%) Frame = -1 Query: 252 DMVYKLIIKSELFVPKDRGGKVFVSPDYNQSMEQQREMTMRRIQYLVRHGVFDGFLTTD- 76 D +Y L+++S LF K+RGGK+FVSPDYNQ+MEQQRE+TM+RI YL+ +GVF G+LT Sbjct: 66 DWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGWLTETG 125 Query: 75 ---ELRSFAIADAVGAYDHSLGIKLGVH 1 ELR A+ + G YDHS+ IK+GVH Sbjct: 126 PEAELRKLALLEVCGIYDHSVSIKVGVH 153 >gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana] Length = 675 Score = 105 bits (263), Expect = 3e-21 Identities = 51/88 (57%), Positives = 67/88 (76%), Gaps = 4/88 (4%) Frame = -1 Query: 252 DMVYKLIIKSELFVPKDRGGKVFVSPDYNQSMEQQREMTMRRIQYLVRHGVFDGFLTTD- 76 D +Y L+++S LF K+RGGK+FVSPDYNQ+MEQQRE+TM+RI YL+ +GVF G+LT Sbjct: 66 DWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGWLTETG 125 Query: 75 ---ELRSFAIADAVGAYDHSLGIKLGVH 1 ELR A+ + G YDHS+ IK+GVH Sbjct: 126 PEAELRKLALLEVCGIYDHSVSIKVGVH 153 >ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] gi|342161829|sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA oxidase; Short=AtCX3; Flags: Precursor gi|8515709|gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana] gi|20466227|gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana] gi|30725500|gb|AAP37772.1| At1g06290 [Arabidopsis thaliana] gi|51970656|dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana] gi|332189851|gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] Length = 675 Score = 105 bits (263), Expect = 3e-21 Identities = 51/88 (57%), Positives = 67/88 (76%), Gaps = 4/88 (4%) Frame = -1 Query: 252 DMVYKLIIKSELFVPKDRGGKVFVSPDYNQSMEQQREMTMRRIQYLVRHGVFDGFLTTD- 76 D +Y L+++S LF K+RGGK+FVSPDYNQ+MEQQRE+TM+RI YL+ +GVF G+LT Sbjct: 66 DWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGWLTETG 125 Query: 75 ---ELRSFAIADAVGAYDHSLGIKLGVH 1 ELR A+ + G YDHS+ IK+GVH Sbjct: 126 PEAELRKLALLEVCGIYDHSVSIKVGVH 153