BLASTX nr result
ID: Cnidium21_contig00021345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021345 (904 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632859.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_004141838.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_003632859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Vitis vinifera] gi|297743240|emb|CBI36107.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 74.3 bits (181), Expect = 4e-11 Identities = 47/107 (43%), Positives = 60/107 (56%), Gaps = 33/107 (30%) Frame = +2 Query: 365 PLTKPTFTI--------RCGPRD----------------QAAQSLKRYPQNDGV------ 454 P+ KP TI RCGPRD QA QSLKR + D Sbjct: 15 PIKKPVQTITTTSYTPIRCGPRDNRGPLMKGRVLSIEAIQAIQSLKRAHRGDPTKIDDFL 74 Query: 455 ---LSRLLKSDLIAALNELLRQDETELAVKVYSAIRSELWYTGDLCI 586 LSRL+K+DL+A LNELLRQD+ +LA++V+SA+RSELWY +L + Sbjct: 75 SKTLSRLVKADLLATLNELLRQDQCDLALRVFSAVRSELWYKTELSL 121 >ref|XP_004141838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] gi|449491766|ref|XP_004158997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] Length = 230 Score = 57.8 bits (138), Expect = 3e-06 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 25/85 (29%) Frame = +2 Query: 380 TFTIRCGPRD----------------QAAQSLKRYPQNDGV---------LSRLLKSDLI 484 +F +RCGPRD QA QSLKR ++D LSRLLK+DL+ Sbjct: 30 SFRVRCGPRDNRGPLVKGRTLSIEAIQAIQSLKRAERSDPTKLQQVLSTTLSRLLKADLV 89 Query: 485 AALNELLRQDETELAVKVYSAIRSE 559 A L ELLRQ+ LA++V++ I+SE Sbjct: 90 ATLKELLRQERCALALEVFAVIKSE 114