BLASTX nr result
ID: Cnidium21_contig00021314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021314 (657 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthu... 78 1e-12 gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel] 78 1e-12 emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus ros... 78 1e-12 ref|XP_002511592.1| Ethylene-responsive transcription factor, pu... 78 2e-12 gb|AAM65925.1| putative ethylene response element binding protei... 77 2e-12 >gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthus roseus] Length = 200 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 655 LGTYETPEDAALAYDRAAFKIHGSAAKLNFPHLIGKNIPEPIKVTPRQR 509 LGTYETPEDAALAYD AAF + G+ A+LNFPHLIG NI P++V PR+R Sbjct: 127 LGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel] Length = 203 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 655 LGTYETPEDAALAYDRAAFKIHGSAAKLNFPHLIGKNIPEPIKVTPRQR 509 LGTYETPEDAALAYD AAF + G+ A+LNFPHLIG NI P++V PR+R Sbjct: 127 LGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus roseus] gi|8980315|emb|CAB96900.1| AP2-domain DNA-binding protein [Catharanthus roseus] Length = 203 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 655 LGTYETPEDAALAYDRAAFKIHGSAAKLNFPHLIGKNIPEPIKVTPRQR 509 LGTYETPEDAALAYD AAF + G+ A+LNFPHLIG NI P++V PR+R Sbjct: 127 LGTYETPEDAALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis] gi|223548772|gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis] Length = 223 Score = 77.8 bits (190), Expect = 2e-12 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 655 LGTYETPEDAALAYDRAAFKIHGSAAKLNFPHLIGKNIPEPIKVTPRQR 509 LGTYETPEDAALAYDRAAFK+ G+ AKLNFPHLIG + EP++V+ R+R Sbjct: 127 LGTYETPEDAALAYDRAAFKMRGTKAKLNFPHLIGSDDLEPVRVSNRRR 175 >gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] Length = 226 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -3 Query: 655 LGTYETPEDAALAYDRAAFKIHGSAAKLNFPHLIGKNIPEPIKVTPRQR 509 LGTYETPEDAA+AYDRAAF++ GS AKLNFPHLIG EP+++ PR+R Sbjct: 119 LGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRR 167