BLASTX nr result
ID: Cnidium21_contig00021261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021261 (921 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] 65 3e-08 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 65 3e-08 gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] 65 3e-08 gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 64 4e-08 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 64 5e-08 >gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] Length = 118 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -3 Query: 586 WSVEAMPTFIFLKQGKLVDKVVGAKKEDIHQTIIKH 479 W+VEAMPTF+FLK+GK++DKVVGAKKE++ QTI KH Sbjct: 76 WAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH 111 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -3 Query: 586 WSVEAMPTFIFLKQGKLVDKVVGAKKEDIHQTIIKH 479 W+VEAMPTF+FLK+GK++DKVVGAKKE++ QTI KH Sbjct: 76 WAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH 111 >gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] Length = 118 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -3 Query: 586 WSVEAMPTFIFLKQGKLVDKVVGAKKEDIHQTIIKH 479 W+VEAMPTF+FLK+GK+VDKVVGAKKE++ TI+KH Sbjct: 76 WAVEAMPTFMFLKEGKIVDKVVGAKKEELQMTIVKH 111 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 64.3 bits (155), Expect = 4e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 586 WSVEAMPTFIFLKQGKLVDKVVGAKKEDIHQTIIKH 479 WSVEAMPTF+FLK GK VD+VVGAKKE++ QTI+KH Sbjct: 76 WSVEAMPTFVFLKDGKEVDRVVGAKKEELQQTILKH 111 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 63.9 bits (154), Expect = 5e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 586 WSVEAMPTFIFLKQGKLVDKVVGAKKEDIHQTIIKH 479 WSVEAMPTF+F+K GK VD+VVGAKKE++ QTI+KH Sbjct: 83 WSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKH 118