BLASTX nr result
ID: Cnidium21_contig00021233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021233 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533395.1| ankyrin repeat-containing protein, putative ... 57 2e-06 >ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 575 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 1/89 (1%) Frame = -3 Query: 265 RTALHAAVLTCRGGECVKLLLLKGNTNLVEVQDDYGWTAFHFVAYKNFHRIVSLLVAEDK 86 +TALHAA + GG + +L T+LV D+ GWT H+ AY R+V L+ DK Sbjct: 211 KTALHAAAMHRHGG--IVHAILDKKTSLVNKADEMGWTPLHYAAYIGASRVVKQLLGYDK 268 Query: 85 YVGNQSVGYKLDK-KKRIAFHVAAYEGAV 2 Y V Y DK ++R A H+AA + + Sbjct: 269 Y-----VAYAADKARRRTALHLAACQANI 292