BLASTX nr result
ID: Cnidium21_contig00021205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021205 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514026.1| Aspartic proteinase nepenthesin-1 precursor,... 158 4e-37 ref|XP_002283889.2| PREDICTED: aspartic proteinase nepenthesin-1... 145 3e-33 gb|ACE96817.1| aspartyl protease [Populus tremula] 145 3e-33 gb|ACE96805.1| aspartyl protease [Populus tremula] gi|190896586|... 145 3e-33 ref|XP_002302336.1| predicted protein [Populus trichocarpa] gi|2... 145 3e-33 >ref|XP_002514026.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] gi|223547112|gb|EEF48609.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] Length = 437 Score = 158 bits (400), Expect = 4e-37 Identities = 73/99 (73%), Positives = 84/99 (84%) Frame = +1 Query: 1 CTGCTQCTSTIFSPNGSSTYVPLDCSMSECTQVRGLSCPASGTGTCLFNQSYGGDSSFSA 180 C+GCT C+ST FS N SSTY LDCSM++CTQVRG SCPA+G+ +C+FNQSYGGDSSFSA Sbjct: 125 CSGCTGCSSTTFSTNTSSTYGSLDCSMAQCTQVRGFSCPATGSSSCVFNQSYGGDSSFSA 184 Query: 181 TLSYDSIGLGNDVIPNYAFGCINEVFGKSVPPQGLLGLG 297 TL DS+ L NDVIPN+AFGCIN + G SVPPQGLLGLG Sbjct: 185 TLVEDSLRLVNDVIPNFAFGCINSISGGSVPPQGLLGLG 223 >ref|XP_002283889.2| PREDICTED: aspartic proteinase nepenthesin-1-like [Vitis vinifera] Length = 439 Score = 145 bits (367), Expect = 3e-33 Identities = 64/99 (64%), Positives = 76/99 (76%) Frame = +1 Query: 1 CTGCTQCTSTIFSPNGSSTYVPLDCSMSECTQVRGLSCPASGTGTCLFNQSYGGDSSFSA 180 C C C+S FSPN SSTY L CS+ +CTQVRGLSCP +GT C FNQ+YGGDSSFSA Sbjct: 127 CADCAGCSSPTFSPNTSSTYASLQCSVPQCTQVRGLSCPTTGTAACFFNQTYGGDSSFSA 186 Query: 181 TLSYDSIGLGNDVIPNYAFGCINEVFGKSVPPQGLLGLG 297 LS DS+GL D +P+Y+FGC+N V G ++PPQGLLGLG Sbjct: 187 MLSQDSLGLAVDTLPSYSFGCVNAVSGSTLPPQGLLGLG 225 >gb|ACE96817.1| aspartyl protease [Populus tremula] Length = 339 Score = 145 bits (367), Expect = 3e-33 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = +1 Query: 1 CTGCTQCTSTIFSPNGSSTYVPLDCSMSECTQVRGLSCPASGTGTCLFNQSYGGDSSFSA 180 C+GCT C+ST F PN S+T LDCS ++C+QVRG SCPA+G+ CLFNQSYGGDSS +A Sbjct: 73 CSGCTGCSSTTFLPNASTTLGSLDCSEAQCSQVRGFSCPATGSSACLFNQSYGGDSSLAA 132 Query: 181 TLSYDSIGLGNDVIPNYAFGCINEVFGKSVPPQGLLGLG 297 TL D+I L NDVIP + FGCIN V G S+PPQGLLGLG Sbjct: 133 TLVQDAITLANDVIPGFTFGCINAVSGGSIPPQGLLGLG 171 >gb|ACE96805.1| aspartyl protease [Populus tremula] gi|190896586|gb|ACE96806.1| aspartyl protease [Populus tremula] gi|190896588|gb|ACE96807.1| aspartyl protease [Populus tremula] gi|190896590|gb|ACE96808.1| aspartyl protease [Populus tremula] gi|190896592|gb|ACE96809.1| aspartyl protease [Populus tremula] gi|190896594|gb|ACE96810.1| aspartyl protease [Populus tremula] gi|190896596|gb|ACE96811.1| aspartyl protease [Populus tremula] gi|190896598|gb|ACE96812.1| aspartyl protease [Populus tremula] gi|190896600|gb|ACE96813.1| aspartyl protease [Populus tremula] gi|190896602|gb|ACE96814.1| aspartyl protease [Populus tremula] gi|190896604|gb|ACE96815.1| aspartyl protease [Populus tremula] gi|190896606|gb|ACE96816.1| aspartyl protease [Populus tremula] gi|190896610|gb|ACE96818.1| aspartyl protease [Populus tremula] gi|190896612|gb|ACE96819.1| aspartyl protease [Populus tremula] gi|190896614|gb|ACE96820.1| aspartyl protease [Populus tremula] gi|190896616|gb|ACE96821.1| aspartyl protease [Populus tremula] gi|190896618|gb|ACE96822.1| aspartyl protease [Populus tremula] gi|190896620|gb|ACE96823.1| aspartyl protease [Populus tremula] gi|190896622|gb|ACE96824.1| aspartyl protease [Populus tremula] gi|190896624|gb|ACE96825.1| aspartyl protease [Populus tremula] gi|190896626|gb|ACE96826.1| aspartyl protease [Populus tremula] gi|190896628|gb|ACE96827.1| aspartyl protease [Populus tremula] gi|190896630|gb|ACE96828.1| aspartyl protease [Populus tremula] gi|190896632|gb|ACE96829.1| aspartyl protease [Populus tremula] gi|190896634|gb|ACE96830.1| aspartyl protease [Populus tremula] gi|190896636|gb|ACE96831.1| aspartyl protease [Populus tremula] gi|190896638|gb|ACE96832.1| aspartyl protease [Populus tremula] gi|190896640|gb|ACE96833.1| aspartyl protease [Populus tremula] gi|190896642|gb|ACE96834.1| aspartyl protease [Populus tremula] gi|190896644|gb|ACE96835.1| aspartyl protease [Populus tremula] gi|190896646|gb|ACE96836.1| aspartyl protease [Populus tremula] gi|190896648|gb|ACE96837.1| aspartyl protease [Populus tremula] gi|190896650|gb|ACE96838.1| aspartyl protease [Populus tremula] gi|190896652|gb|ACE96839.1| aspartyl protease [Populus tremula] gi|190896654|gb|ACE96840.1| aspartyl protease [Populus tremula] gi|190896656|gb|ACE96841.1| aspartyl protease [Populus tremula] gi|190896658|gb|ACE96842.1| aspartyl protease [Populus tremula] Length = 339 Score = 145 bits (367), Expect = 3e-33 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = +1 Query: 1 CTGCTQCTSTIFSPNGSSTYVPLDCSMSECTQVRGLSCPASGTGTCLFNQSYGGDSSFSA 180 C+GCT C+ST F PN S+T LDCS ++C+QVRG SCPA+G+ CLFNQSYGGDSS +A Sbjct: 73 CSGCTGCSSTTFLPNASTTLGSLDCSEAQCSQVRGFSCPATGSSACLFNQSYGGDSSLAA 132 Query: 181 TLSYDSIGLGNDVIPNYAFGCINEVFGKSVPPQGLLGLG 297 TL D+I L NDVIP + FGCIN V G S+PPQGLLGLG Sbjct: 133 TLVQDAITLANDVIPGFTFGCINAVSGGSIPPQGLLGLG 171 >ref|XP_002302336.1| predicted protein [Populus trichocarpa] gi|222844062|gb|EEE81609.1| predicted protein [Populus trichocarpa] Length = 438 Score = 145 bits (366), Expect = 3e-33 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = +1 Query: 1 CTGCTQCTSTIFSPNGSSTYVPLDCSMSECTQVRGLSCPASGTGTCLFNQSYGGDSSFSA 180 C+GCT C+ST F PN S+T LDCS ++C+QVRG SCPA+G+ CLFNQSYGGDSS +A Sbjct: 126 CSGCTGCSSTTFLPNASTTLGSLDCSGAQCSQVRGFSCPATGSSACLFNQSYGGDSSLTA 185 Query: 181 TLSYDSIGLGNDVIPNYAFGCINEVFGKSVPPQGLLGLG 297 TL D+I L NDVIP + FGCIN V G S+PPQGLLGLG Sbjct: 186 TLVQDAITLANDVIPGFTFGCINAVSGGSIPPQGLLGLG 224