BLASTX nr result
ID: Cnidium21_contig00021183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021183 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24436.3| unnamed protein product [Vitis vinifera] 75 4e-12 ref|XP_002264570.1| PREDICTED: large subunit GTPase 1 homolog [V... 75 4e-12 ref|XP_003543409.1| PREDICTED: large subunit GTPase 1 homolog [G... 69 3e-10 ref|XP_002513727.1| GTP binding protein, putative [Ricinus commu... 69 3e-10 ref|XP_003538087.1| PREDICTED: large subunit GTPase 1 homolog [G... 68 7e-10 >emb|CBI24436.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 KRTLLLINKADLLPFSIRDKWAKYFHLHGIPFVFWSAKVAS 125 K+TLLL+NKADLLPFS+R++WAKYF LHGI F+FWSAK AS Sbjct: 200 KKTLLLVNKADLLPFSVRERWAKYFRLHGILFIFWSAKAAS 240 >ref|XP_002264570.1| PREDICTED: large subunit GTPase 1 homolog [Vitis vinifera] Length = 597 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 KRTLLLINKADLLPFSIRDKWAKYFHLHGIPFVFWSAKVAS 125 K+TLLL+NKADLLPFS+R++WAKYF LHGI F+FWSAK AS Sbjct: 198 KKTLLLVNKADLLPFSVRERWAKYFRLHGILFIFWSAKAAS 238 >ref|XP_003543409.1| PREDICTED: large subunit GTPase 1 homolog [Glycine max] Length = 573 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 3 KRTLLLINKADLLPFSIRDKWAKYFHLHGIPFVFWSAKVAS 125 KRTLLL+NKADLLP S+R+KW +YFH H I ++FWSAK AS Sbjct: 191 KRTLLLVNKADLLPASVREKWVEYFHAHNILYIFWSAKAAS 231 >ref|XP_002513727.1| GTP binding protein, putative [Ricinus communis] gi|223547178|gb|EEF48674.1| GTP binding protein, putative [Ricinus communis] Length = 596 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 KRTLLLINKADLLPFSIRDKWAKYFHLHGIPFVFWSAKVAS 125 KRTLLL+NKADLLPFS+R KWA+YF H I FVFWSAKVA+ Sbjct: 201 KRTLLLVNKADLLPFSVRQKWAEYFCHHEILFVFWSAKVAT 241 >ref|XP_003538087.1| PREDICTED: large subunit GTPase 1 homolog [Glycine max] Length = 594 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 3 KRTLLLINKADLLPFSIRDKWAKYFHLHGIPFVFWSAKVAS 125 KRTLLL+NKADLLP SIR+KWA+YF H I F+FWSAK A+ Sbjct: 197 KRTLLLVNKADLLPVSIREKWAEYFRAHDILFIFWSAKAAT 237