BLASTX nr result
ID: Cnidium21_contig00020866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00020866 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222704.1| hypothetical chloroplast RF19 [Anthriscus ce... 65 6e-09 gb|ADD30919.1| putative RF1 protein [Liquidambar styraciflua] 63 3e-08 ref|YP_007317307.1| Ycf1 (chloroplast) [Camellia sinensis] gi|43... 62 4e-08 ref|YP_004935611.1| ycf1 protein (chloroplast) [Eleutherococcus ... 62 5e-08 ref|YP_087024.1| ycf1 protein [Panax ginseng] gi|75117190|sp|Q68... 60 1e-07 >ref|YP_004222704.1| hypothetical chloroplast RF19 [Anthriscus cerefolium] gi|289645633|gb|ADD13696.1| hypothetical chloroplast RF19 [Anthriscus cerefolium] Length = 1793 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 347 FFYISSLSQAYVFYKFSQTQVINLYKLRSIFEYH 246 FF +SSLSQAYVFYK SQTQVINLYKLRSIFEYH Sbjct: 1143 FFDLSSLSQAYVFYKLSQTQVINLYKLRSIFEYH 1176 >gb|ADD30919.1| putative RF1 protein [Liquidambar styraciflua] Length = 1882 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 347 FFYISSLSQAYVFYKFSQTQVINLYKLRSIFEYHTTYCLTK 225 FF +SSLSQAYVFYK SQTQVINLYKLRS+ +YH T K Sbjct: 1216 FFDLSSLSQAYVFYKLSQTQVINLYKLRSVIQYHGTSLFLK 1256 >ref|YP_007317307.1| Ycf1 (chloroplast) [Camellia sinensis] gi|430728331|gb|AGA55655.1| Ycf1 (chloroplast) [Camellia sinensis] Length = 1873 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 350 SFFYISSLSQAYVFYKFSQTQVINLYKLRSIFEYHTT 240 +FF +SSLSQAYVFYK SQTQV+NLYKLRSI +YH T Sbjct: 1193 NFFDLSSLSQAYVFYKISQTQVLNLYKLRSILQYHGT 1229 >ref|YP_004935611.1| ycf1 protein (chloroplast) [Eleutherococcus senticosus] gi|347448265|gb|AEO92677.1| ycf1 protein (chloroplast) [Eleutherococcus senticosus] Length = 1875 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 347 FFYISSLSQAYVFYKFSQTQVINLYKLRSIFEYHTT 240 FF +SSLSQAYVFYK SQT+VINLYKLRS+ EYH T Sbjct: 1194 FFDLSSLSQAYVFYKLSQTRVINLYKLRSVLEYHGT 1229 >ref|YP_087024.1| ycf1 protein [Panax ginseng] gi|75117190|sp|Q68RU8.1|YCF1_PANGI RecName: Full=Putative membrane protein ycf1 gi|51235372|gb|AAT98568.1| ycf1 protein [Panax ginseng] Length = 1919 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 347 FFYISSLSQAYVFYKFSQTQVINLYKLRSIFEYHTT 240 FF +SSLSQAYVFYK S+T+VINLYKLRS+ EYH T Sbjct: 1238 FFDLSSLSQAYVFYKLSRTRVINLYKLRSVLEYHGT 1273