BLASTX nr result
ID: Cnidium21_contig00020361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00020361 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263663.2| PREDICTED: sister chromatid cohesion 1 prote... 75 5e-12 emb|CBI24843.3| unnamed protein product [Vitis vinifera] 75 5e-12 ref|XP_002299652.1| predicted protein [Populus trichocarpa] gi|2... 75 7e-12 ref|XP_002513194.1| cohesin subunit rad21, putative [Ricinus com... 72 6e-11 ref|XP_002876510.1| hypothetical protein ARALYDRAFT_486422 [Arab... 69 3e-10 >ref|XP_002263663.2| PREDICTED: sister chromatid cohesion 1 protein 3-like [Vitis vinifera] Length = 761 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 194 MFYSNTFLARKGPLGTGWCAAHLQSRLKKSHITATNIPKTV 72 MFYS+TFLARKGPLGT WCAAHLQ +LKKSH TAT+IP TV Sbjct: 1 MFYSHTFLARKGPLGTVWCAAHLQHKLKKSHYTATDIPSTV 41 >emb|CBI24843.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 194 MFYSNTFLARKGPLGTGWCAAHLQSRLKKSHITATNIPKTV 72 MFYS+TFLARKGPLGT WCAAHLQ +LKKSH TAT+IP TV Sbjct: 1 MFYSHTFLARKGPLGTVWCAAHLQHKLKKSHYTATDIPSTV 41 >ref|XP_002299652.1| predicted protein [Populus trichocarpa] gi|222846910|gb|EEE84457.1| predicted protein [Populus trichocarpa] Length = 818 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 194 MFYSNTFLARKGPLGTGWCAAHLQSRLKKSHITATNIPKTV 72 MFYS TFLARKGPLGT WCAAHLQ RLKKSH T+T+IP TV Sbjct: 1 MFYSQTFLARKGPLGTVWCAAHLQHRLKKSHYTSTDIPSTV 41 >ref|XP_002513194.1| cohesin subunit rad21, putative [Ricinus communis] gi|223547692|gb|EEF49185.1| cohesin subunit rad21, putative [Ricinus communis] Length = 774 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 194 MFYSNTFLARKGPLGTGWCAAHLQSRLKKSHITATNIPKTV 72 MFYS TFLARKGPLGT WCAAHLQ RLKKSH T+T+I TV Sbjct: 1 MFYSQTFLARKGPLGTVWCAAHLQHRLKKSHYTSTDISSTV 41 >ref|XP_002876510.1| hypothetical protein ARALYDRAFT_486422 [Arabidopsis lyrata subsp. lyrata] gi|297322348|gb|EFH52769.1| hypothetical protein ARALYDRAFT_486422 [Arabidopsis lyrata subsp. lyrata] Length = 696 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 194 MFYSNTFLARKGPLGTGWCAAHLQSRLKKSHITATNIPKTV 72 MFYS+T LARKGPLGT WCAAH+Q RLKKS TA NIP TV Sbjct: 1 MFYSHTLLARKGPLGTVWCAAHVQHRLKKSQYTAVNIPDTV 41