BLASTX nr result
ID: Cnidium21_contig00020353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00020353 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554985.1| PREDICTED: putative glucose-6-phosphate 1-ep... 59 5e-07 gb|ACN40722.1| unknown [Picea sitchensis] 58 7e-07 ref|XP_002521477.1| aldose 1-epimerase, putative [Ricinus commun... 58 9e-07 ref|XP_002272928.1| PREDICTED: putative glucose-6-phosphate 1-ep... 58 9e-07 ref|XP_002521479.1| aldose 1-epimerase, putative [Ricinus commun... 57 1e-06 >ref|XP_003554985.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Glycine max] Length = 305 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 162 RVEGLETLDYFDILLDRERFTEQADALTFDG 254 R+EGLETLDYFD LL+R RFTEQADALTFDG Sbjct: 169 RIEGLETLDYFDNLLNRSRFTEQADALTFDG 199 >gb|ACN40722.1| unknown [Picea sitchensis] Length = 304 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 111 YTFLIYDVF*IAVKCVCRVEGLETLDYFDILLDRERFTEQADALTFD 251 +TF ++ ++ RVEGLETLDYFD LL +ERFTEQADA+TFD Sbjct: 153 FTFALHTYLSVSDISEVRVEGLETLDYFDNLLQKERFTEQADAITFD 199 >ref|XP_002521477.1| aldose 1-epimerase, putative [Ricinus communis] gi|223539376|gb|EEF40967.1| aldose 1-epimerase, putative [Ricinus communis] Length = 305 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +3 Query: 105 LYYTFLIYDVF*IAVKCVCRVEGLETLDYFDILLDRERFTEQADALTFD 251 L +TF + + ++ RVEGLETLDYFD L+ RERFTEQADA+TFD Sbjct: 151 LSFTFALCNYLSVSDISEVRVEGLETLDYFDNLMRRERFTEQADAITFD 199 >ref|XP_002272928.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Vitis vinifera] gi|296087598|emb|CBI34854.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 162 RVEGLETLDYFDILLDRERFTEQADALTFDG 254 RVEGLETLDYFD L+ RER+TEQADA+TFDG Sbjct: 170 RVEGLETLDYFDNLMQRERYTEQADAITFDG 200 >ref|XP_002521479.1| aldose 1-epimerase, putative [Ricinus communis] gi|223539378|gb|EEF40969.1| aldose 1-epimerase, putative [Ricinus communis] Length = 306 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +3 Query: 111 YTFLIYDVF*IAVKCVCRVEGLETLDYFDILLDRERFTEQADALTFD 251 +TF + + ++ R+EGLETLDYFD L+ RERFTEQADA+TFD Sbjct: 153 FTFALCNYLSVSDISEVRIEGLETLDYFDNLMQRERFTEQADAITFD 199