BLASTX nr result
ID: Cnidium21_contig00020048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00020048 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136296.1| PREDICTED: signal peptide peptidase-like [Cu... 76 3e-12 ref|XP_002280005.1| PREDICTED: minor histocompatibility antigen ... 76 3e-12 ref|XP_002527044.1| Minor histocompatibility antigen H13, putati... 75 4e-12 ref|XP_003526473.1| PREDICTED: minor histocompatibility antigen ... 75 7e-12 gb|AFK47899.1| unknown [Lotus japonicus] 74 1e-11 >ref|XP_004136296.1| PREDICTED: signal peptide peptidase-like [Cucumis sativus] Length = 341 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -2 Query: 164 MKNGERXXXXXXXXXXXXXLIMKVDPNLNVVLTACLTVYVGCYRSVKPTPPTET 3 MKN ER L+MKVDPN+NVVLTACLTVYVGCYRSVKPTPP+ET Sbjct: 1 MKNAERIANFALAGLTLAPLVMKVDPNVNVVLTACLTVYVGCYRSVKPTPPSET 54 >ref|XP_002280005.1| PREDICTED: minor histocompatibility antigen H13 [Vitis vinifera] gi|296083844|emb|CBI24232.3| unnamed protein product [Vitis vinifera] Length = 341 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -2 Query: 164 MKNGERXXXXXXXXXXXXXLIMKVDPNLNVVLTACLTVYVGCYRSVKPTPPTET 3 MKN ER L+MKVDPNLNV+LTACLTVYVGCYRSVKPTPP+ET Sbjct: 1 MKNCERLANLGLAGLTLAPLVMKVDPNLNVILTACLTVYVGCYRSVKPTPPSET 54 >ref|XP_002527044.1| Minor histocompatibility antigen H13, putative [Ricinus communis] gi|223533606|gb|EEF35344.1| Minor histocompatibility antigen H13, putative [Ricinus communis] Length = 341 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = -2 Query: 164 MKNGERXXXXXXXXXXXXXLIMKVDPNLNVVLTACLTVYVGCYRSVKPTPPTET 3 MKNGER L++KVDPNLNV+LTACL VYVGCYRSVKPTPP ET Sbjct: 1 MKNGERLANIALAGLTLAPLVVKVDPNLNVILTACLAVYVGCYRSVKPTPPAET 54 >ref|XP_003526473.1| PREDICTED: minor histocompatibility antigen H13-like [Glycine max] Length = 341 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = -2 Query: 164 MKNGERXXXXXXXXXXXXXLIMKVDPNLNVVLTACLTVYVGCYRSVKPTPPTET 3 MKN ER L++KVDPNLNV+LTACLTV+VGCYRSVKPTPPTET Sbjct: 1 MKNTERIANLALAGLTLAPLVVKVDPNLNVILTACLTVFVGCYRSVKPTPPTET 54 >gb|AFK47899.1| unknown [Lotus japonicus] Length = 341 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -2 Query: 164 MKNGERXXXXXXXXXXXXXLIMKVDPNLNVVLTACLTVYVGCYRSVKPTPPTET 3 MKN ER L++KVDPNLNV+LTAC+TV+VGCYRSVKPTPPTET Sbjct: 1 MKNTERLANFALLGLTLAPLVVKVDPNLNVILTACITVFVGCYRSVKPTPPTET 54