BLASTX nr result
ID: Cnidium21_contig00019888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019888 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37358.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002267137.2| PREDICTED: uncharacterized protein LOC100266... 61 8e-08 emb|CAN66568.1| hypothetical protein VITISV_039539 [Vitis vinifera] 61 8e-08 emb|CAN74654.1| hypothetical protein VITISV_022993 [Vitis vinifera] 61 8e-08 ref|XP_002304281.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 >emb|CBI37358.3| unnamed protein product [Vitis vinifera] Length = 1979 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -2 Query: 151 TYLLCPKPMDYDNNEFEGHSHKLSGEESSKLSPALHPYALPKFDFDDNLQ 2 TY PMDYD+N+F+ + +L+GE S+K P L PYALPKFDFDD+LQ Sbjct: 40 TYFFWDTPMDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQ 89 >ref|XP_002267137.2| PREDICTED: uncharacterized protein LOC100266068 [Vitis vinifera] Length = 2292 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 127 MDYDNNEFEGHSHKLSGEESSKLSPALHPYALPKFDFDDNLQ 2 MDYD+N+F+ + +L+GE S+K P L PYALPKFDFDD+LQ Sbjct: 1 MDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQ 42 >emb|CAN66568.1| hypothetical protein VITISV_039539 [Vitis vinifera] Length = 2321 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 127 MDYDNNEFEGHSHKLSGEESSKLSPALHPYALPKFDFDDNLQ 2 MDYD+N+F+ + +L+GE S+K P L PYALPKFDFDD+LQ Sbjct: 1 MDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQ 42 >emb|CAN74654.1| hypothetical protein VITISV_022993 [Vitis vinifera] Length = 644 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 127 MDYDNNEFEGHSHKLSGEESSKLSPALHPYALPKFDFDDNLQ 2 MDYD+N+F+ + +L+GE S+K P L PYALPKFDFDD+LQ Sbjct: 1 MDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQ 42 >ref|XP_002304281.1| predicted protein [Populus trichocarpa] gi|222841713|gb|EEE79260.1| predicted protein [Populus trichocarpa] Length = 2105 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 127 MDYDNNEFEGHSHKLSGEESSKLSPALHPYALPKFDFDDNL 5 MDYD+N+F+ H+ L GE S+K P L PYALPKFDFDD+L Sbjct: 1 MDYDDNDFQSHNLHLVGEGSNKFPPVLQPYALPKFDFDDSL 41