BLASTX nr result
ID: Cnidium21_contig00019625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019625 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like... 89 4e-16 ref|XP_002524078.1| ring finger protein, putative [Ricinus commu... 87 1e-15 ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein A... 85 5e-15 ref|XP_003535824.1| PREDICTED: RING-H2 finger protein ATL70-like... 82 3e-14 ref|XP_003520719.1| PREDICTED: RING-H2 finger protein ATL70-like... 82 3e-14 >ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like [Vitis vinifera] Length = 169 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/53 (77%), Positives = 41/53 (77%) Frame = -3 Query: 363 LRLLPDCGHLFHLKCVDPWLRSHPTCPVCRXXXXXXXXXXXLAEVVPLATRRD 205 LRLLPDCGHLFHLKCVDPWLR HPTCPVCR LAEVVPLATRRD Sbjct: 117 LRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPMPTPLSTPLAEVVPLATRRD 169 >ref|XP_002524078.1| ring finger protein, putative [Ricinus communis] gi|223536646|gb|EEF38288.1| ring finger protein, putative [Ricinus communis] Length = 172 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/53 (75%), Positives = 41/53 (77%) Frame = -3 Query: 363 LRLLPDCGHLFHLKCVDPWLRSHPTCPVCRXXXXXXXXXXXLAEVVPLATRRD 205 LRLLPDCGHLFHLKCVDPWLR HPTCPVCR LAEVVPLA+RRD Sbjct: 120 LRLLPDCGHLFHLKCVDPWLRLHPTCPVCRNSPLPTPLSTPLAEVVPLASRRD 172 >ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Cucumis sativus] Length = 172 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -3 Query: 363 LRLLPDCGHLFHLKCVDPWLRSHPTCPVCRXXXXXXXXXXXLAEVVPLATRRD 205 LRLLPDCGHLFHLKCVDPWLR HPTCPVCR LAE VPLA+RRD Sbjct: 120 LRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEQVPLASRRD 172 >ref|XP_003535824.1| PREDICTED: RING-H2 finger protein ATL70-like [Glycine max] Length = 168 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -3 Query: 363 LRLLPDCGHLFHLKCVDPWLRSHPTCPVCRXXXXXXXXXXXLAEVVPLATRRD 205 LR+LPDC H+FHLKC+DPWLR HPTCP+CR LAEVVPLATRRD Sbjct: 116 LRVLPDCDHVFHLKCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVVPLATRRD 168 >ref|XP_003520719.1| PREDICTED: RING-H2 finger protein ATL70-like [Glycine max] Length = 171 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -3 Query: 363 LRLLPDCGHLFHLKCVDPWLRSHPTCPVCRXXXXXXXXXXXLAEVVPLATRRD 205 LR+LPDCGH FHLKC+DPWLR HPTCPVCR LAEVVPLA+R+D Sbjct: 118 LRMLPDCGHQFHLKCIDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLASRQD 170