BLASTX nr result
ID: Cnidium21_contig00019491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019491 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519231.1| map3k delta-1 protein kinase, putative [Rici... 55 8e-06 ref|XP_002314950.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002519231.1| map3k delta-1 protein kinase, putative [Ricinus communis] gi|223541546|gb|EEF43095.1| map3k delta-1 protein kinase, putative [Ricinus communis] Length = 796 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 341 PKSRPTFQELLEKLKDLLRQHVAQSQAARSNAGDGT*RE 225 P+ RPTFQELLEKL+DL RQ+ Q QAARS AGD T +E Sbjct: 757 PQCRPTFQELLEKLRDLQRQYAIQFQAARSAAGDNTQKE 795 >ref|XP_002314950.1| predicted protein [Populus trichocarpa] gi|222863990|gb|EEF01121.1| predicted protein [Populus trichocarpa] Length = 781 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 341 PKSRPTFQELLEKLKDLLRQHVAQSQAARSNAGDGT*RE 225 P+ RPTFQELLEKL+DL RQ+ Q QAARS AGD T +E Sbjct: 742 PQCRPTFQELLEKLRDLQRQYAIQFQAARSAAGDNTQKE 780