BLASTX nr result
ID: Cnidium21_contig00019483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019483 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300091.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 ref|XP_002323991.1| predicted protein [Populus trichocarpa] gi|2... 76 2e-12 ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit ... 73 3e-11 ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putati... 72 4e-11 gb|AFK44725.1| unknown [Medicago truncatula] 72 6e-11 >ref|XP_002300091.1| predicted protein [Populus trichocarpa] gi|222847349|gb|EEE84896.1| predicted protein [Populus trichocarpa] Length = 423 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -3 Query: 365 IERIDSSIERMMTLSKKLTATDELMSCDPAYLSRVGKERAPRLDFDDYDP 216 IE IDSSI+R+MTLSKKLTA DEL+SCDP YL++VG+ER R DFDD+DP Sbjct: 368 IEHIDSSIQRIMTLSKKLTAMDELISCDPLYLAKVGRER-QRFDFDDFDP 416 >ref|XP_002323991.1| predicted protein [Populus trichocarpa] gi|222866993|gb|EEF04124.1| predicted protein [Populus trichocarpa] Length = 424 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -3 Query: 365 IERIDSSIERMMTLSKKLTATDELMSCDPAYLSRVGKERAPRLDFDDYDP 216 IE IDSSI+R+MTLSKKLTA DEL+SCDP YL++ G+ER R DFDD+DP Sbjct: 369 IEHIDSSIQRIMTLSKKLTAVDELLSCDPLYLAKAGRER-QRFDFDDFDP 417 >ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit 3 [Vitis vinifera] gi|296090247|emb|CBI40066.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 365 IERIDSSIERMMTLSKKLTATDELMSCDPAYLSRVGKERAPRLDFDDYD 219 IE IDSSI+R+MTLSKKLT DEL+SCDP YL++ G+ER R DFDDYD Sbjct: 369 IEHIDSSIQRIMTLSKKLTTMDELISCDPLYLAKAGRER-QRFDFDDYD 416 >ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] gi|223549455|gb|EEF50943.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] Length = 427 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 365 IERIDSSIERMMTLSKKLTATDELMSCDPAYLSRVGKERAPRLDFDDYD 219 IE IDSSI+R+M LSKKLTA DELMSCDP YL++ G+ER R DFDD+D Sbjct: 372 IEHIDSSIQRIMNLSKKLTAMDELMSCDPLYLAKAGRER-QRFDFDDFD 419 >gb|AFK44725.1| unknown [Medicago truncatula] Length = 92 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 365 IERIDSSIERMMTLSKKLTATDELMSCDPAYLSRVGKERAPRLDFDDYD 219 IE IDSSI+R+M LSKKLTATDE +SCD YLS+VG+ER R DFDDYD Sbjct: 38 IEHIDSSIQRIMALSKKLTATDEQISCDQLYLSKVGRER-QRYDFDDYD 85