BLASTX nr result
ID: Cnidium21_contig00019229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019229 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A05190 hypothetical protein 77 - common tobacco chloroplast... 75 7e-12 ref|XP_003599571.1| Photosystem I assembly protein Ycf3 [Medicag... 55 6e-06 >pir||A05190 hypothetical protein 77 - common tobacco chloroplast gi|225199|prf||1211235AD ORF 77 Length = 77 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 ISLSNGLFSPVGIGESIPSLRTVLESFLPHTAQQSILLVSYF 126 ISL NGLFSP GIG SIPSLRTVLE+FLPHTAQQSILLVS+F Sbjct: 31 ISLLNGLFSPAGIGSSIPSLRTVLENFLPHTAQQSILLVSHF 72 >ref|XP_003599571.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] gi|355488619|gb|AES69822.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] Length = 160 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 93 RMR*ETLKYGSKGRN*LAYSDRGEQAIRQGD 1 RM ETLKYGSKGRN L YSDRGEQAIRQGD Sbjct: 90 RMSQETLKYGSKGRNLLTYSDRGEQAIRQGD 120