BLASTX nr result
ID: Cnidium21_contig00019137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019137 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524764.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002524764.1| conserved hypothetical protein [Ricinus communis] gi|223535948|gb|EEF37607.1| conserved hypothetical protein [Ricinus communis] Length = 204 Score = 59.7 bits (143), Expect = 2e-07 Identities = 36/91 (39%), Positives = 46/91 (50%) Frame = +3 Query: 63 YSERWAGXXXXXXXXXXXXXXXXXXVPSKRSVSLELPCLESEVYLHXXXXXXXXXXRREH 242 +SERWAG + KR+VSLELP +S + +H REH Sbjct: 114 FSERWAGPAYSNSPPPSSLPIPKFSMRPKRTVSLELPVCDSGIKVHSFAKSAPSSPTREH 173 Query: 243 GNSARNGVYSADYASATKDLRRILNLDMTDE 335 +S R + S D SATK LRRILNLD+ D+ Sbjct: 174 NSSTRELLLSVD--SATKTLRRILNLDVVDD 202