BLASTX nr result
ID: Cnidium21_contig00019108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00019108 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267755.1| PREDICTED: luc7-like protein 3-like [Vitis v... 62 4e-08 emb|CBI24598.3| unnamed protein product [Vitis vinifera] 62 4e-08 emb|CAN72521.1| hypothetical protein VITISV_039964 [Vitis vinifera] 62 4e-08 ref|XP_003534368.1| PREDICTED: luc7-like protein 3-like [Glycine... 61 1e-07 gb|ACU23230.1| unknown [Glycine max] 61 1e-07 >ref|XP_002267755.1| PREDICTED: luc7-like protein 3-like [Vitis vinifera] Length = 358 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 233 GYKETTWYDKDVCGFYMVRFCPHDLFVKERPRL 331 GYKE TW DK+VCGFYMVRFCPHDLFV R L Sbjct: 25 GYKEVTWDDKEVCGFYMVRFCPHDLFVNTRSDL 57 >emb|CBI24598.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 233 GYKETTWYDKDVCGFYMVRFCPHDLFVKERPRL 331 GYKE TW DK+VCGFYMVRFCPHDLFV R L Sbjct: 25 GYKEVTWDDKEVCGFYMVRFCPHDLFVNTRSDL 57 >emb|CAN72521.1| hypothetical protein VITISV_039964 [Vitis vinifera] Length = 363 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 233 GYKETTWYDKDVCGFYMVRFCPHDLFVKERPRL 331 GYKE TW DK+VCGFYMVRFCPHDLFV R L Sbjct: 25 GYKEVTWDDKEVCGFYMVRFCPHDLFVNTRSDL 57 >ref|XP_003534368.1| PREDICTED: luc7-like protein 3-like [Glycine max] Length = 342 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 233 GYKETTWYDKDVCGFYMVRFCPHDLFVKERPRL 331 GYKE +W DK+VCGFYMVRFCPHDLFV R L Sbjct: 25 GYKEVSWDDKEVCGFYMVRFCPHDLFVNTRSDL 57 >gb|ACU23230.1| unknown [Glycine max] Length = 342 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 233 GYKETTWYDKDVCGFYMVRFCPHDLFVKERPRL 331 GYKE +W DK+VCGFYMVRFCPHDLFV R L Sbjct: 25 GYKEVSWDDKEVCGFYMVRFCPHDLFVNTRSDL 57