BLASTX nr result
ID: Cnidium21_contig00018958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018958 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269871.1| PREDICTED: uncharacterized protein LOC100264... 65 8e-09 ref|XP_002269835.1| PREDICTED: uncharacterized protein LOC100264... 65 8e-09 ref|XP_002888297.1| hypothetical protein ARALYDRAFT_475501 [Arab... 64 2e-08 emb|CAN78229.1| hypothetical protein VITISV_020275 [Vitis vinifera] 63 3e-08 ref|NP_176678.1| Nucleotide-diphospho-sugar transferases superfa... 62 4e-08 >ref|XP_002269871.1| PREDICTED: uncharacterized protein LOC100264930 isoform 2 [Vitis vinifera] Length = 268 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 325 LGGPWFEDWKDCEFGDLWLNELEEYNKASEK 233 LGGPWFE WKDCEFGDLWLNE+EEY K + K Sbjct: 234 LGGPWFEAWKDCEFGDLWLNEMEEYKKEANK 264 >ref|XP_002269835.1| PREDICTED: uncharacterized protein LOC100264930 isoform 1 [Vitis vinifera] gi|359489862|ref|XP_003633988.1| PREDICTED: uncharacterized protein LOC100264930 [Vitis vinifera] Length = 254 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 325 LGGPWFEDWKDCEFGDLWLNELEEYNKASEK 233 LGGPWFE WKDCEFGDLWLNE+EEY K + K Sbjct: 220 LGGPWFEAWKDCEFGDLWLNEMEEYKKEANK 250 >ref|XP_002888297.1| hypothetical protein ARALYDRAFT_475501 [Arabidopsis lyrata subsp. lyrata] gi|297334138|gb|EFH64556.1| hypothetical protein ARALYDRAFT_475501 [Arabidopsis lyrata subsp. lyrata] Length = 260 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 322 GGPWFEDWKDCEFGDLWLNELEEYNKASEK 233 GGPWF+ WKDCEF DLWLNE+EEYNK S+K Sbjct: 224 GGPWFDAWKDCEFADLWLNEMEEYNKESKK 253 >emb|CAN78229.1| hypothetical protein VITISV_020275 [Vitis vinifera] Length = 121 Score = 62.8 bits (151), Expect = 3e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 325 LGGPWFEDWKDCEFGDLWLNELEEYNK 245 LGGPWFE WKDCEFGDLWLNE+EEY K Sbjct: 86 LGGPWFEAWKDCEFGDLWLNEMEEYKK 112 >ref|NP_176678.1| Nucleotide-diphospho-sugar transferases superfamily protein [Arabidopsis thaliana] gi|5042435|gb|AAD38274.1|AC006193_30 Unknown protein [Arabidopsis thaliana] gi|34146814|gb|AAQ62415.1| At1g64980 [Arabidopsis thaliana] gi|51970684|dbj|BAD44034.1| hypothetical protein [Arabidopsis thaliana] gi|332196190|gb|AEE34311.1| Nucleotide-diphospho-sugar transferases superfamily protein [Arabidopsis thaliana] Length = 259 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 322 GGPWFEDWKDCEFGDLWLNELEEYNKASEK 233 GGPWF+ WKDCEF DLWLNE+EEYNK ++K Sbjct: 224 GGPWFDAWKDCEFADLWLNEMEEYNKENKK 253