BLASTX nr result
ID: Cnidium21_contig00018891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018891 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323248.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial... 58 9e-07 >ref|XP_002323248.1| predicted protein [Populus trichocarpa] gi|222867878|gb|EEF05009.1| predicted protein [Populus trichocarpa] Length = 171 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 8 RQRRWLTVSEAGDCCRHSWMKEALEEGFRKWLSDGMI 118 RQR WLT+ EAG+CCR+ WMK+ALEE F KWL D MI Sbjct: 135 RQRSWLTIPEAGECCRYKWMKDALEERFTKWLDDQMI 171 >ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|147852980|emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera] gi|297739943|emb|CBI30125.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SLRQRRWLTVSEAGDCCRHSWMKEALEEGFRKWLSDGM-ISTMEENNHI 145 S R+R WLT+ EA + CRH WM++ALEEGF KW D + I+ EE+ HI Sbjct: 133 STRERSWLTIPEAIERCRHPWMRKALEEGFSKWHDDHLKINGKEEDIHI 181