BLASTX nr result
ID: Cnidium21_contig00018705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018705 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447600.1| hypothetical protein SORBIDRAFT_06g005801 [S... 68 9e-10 ref|XP_002450590.1| hypothetical protein SORBIDRAFT_05g007530 [S... 66 3e-09 ref|XP_002450403.1| hypothetical protein SORBIDRAFT_05g004780 [S... 66 3e-09 ref|XP_002452519.1| hypothetical protein SORBIDRAFT_04g027355 [S... 66 3e-09 ref|XP_002457467.1| hypothetical protein SORBIDRAFT_03g007660 [S... 66 3e-09 >ref|XP_002447600.1| hypothetical protein SORBIDRAFT_06g005801 [Sorghum bicolor] gi|241938783|gb|EES11928.1| hypothetical protein SORBIDRAFT_06g005801 [Sorghum bicolor] Length = 232 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 5 HTKKRNRLDSERLSSLVYVQFNSKPINKNKKVQ--DKCDSLLANDSRMAQEWIVEGGDDD 178 HTKKRN+L SERL+ LV+VQ+N+K K K + D LL DS AQ W+VEGGD++ Sbjct: 95 HTKKRNKLTSERLNQLVFVQYNNKMNGKKVKAKKNQNMDPLLGTDSNRAQGWLVEGGDEE 154 Query: 179 ESE 187 ++E Sbjct: 155 DAE 157 >ref|XP_002450590.1| hypothetical protein SORBIDRAFT_05g007530 [Sorghum bicolor] gi|241936433|gb|EES09578.1| hypothetical protein SORBIDRAFT_05g007530 [Sorghum bicolor] Length = 361 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/60 (55%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = +2 Query: 2 IHTKKRNRLDSERLSSLVYVQFNSKPINKNKKVQDK--CDSLLANDSRMAQEWIVEGGDD 175 IHTKKRNRL + RL+ LVY+QFNSK ++K +K++ K D LL++D+ AQ ++ EGGDD Sbjct: 232 IHTKKRNRLTTARLNKLVYIQFNSKLLSKREKIKSKKIIDVLLSSDTCEAQGFLQEGGDD 291 >ref|XP_002450403.1| hypothetical protein SORBIDRAFT_05g004780 [Sorghum bicolor] gi|241936246|gb|EES09391.1| hypothetical protein SORBIDRAFT_05g004780 [Sorghum bicolor] Length = 801 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/60 (55%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = +2 Query: 2 IHTKKRNRLDSERLSSLVYVQFNSKPINKNKKVQDK--CDSLLANDSRMAQEWIVEGGDD 175 IHTKKRNRL + RL+ LVY+QFNSK ++K +K++ K D LL++D+ AQ ++ EGGDD Sbjct: 672 IHTKKRNRLTTARLNKLVYIQFNSKLLSKREKIKSKKIIDVLLSSDTCEAQGFLQEGGDD 731 >ref|XP_002452519.1| hypothetical protein SORBIDRAFT_04g027355 [Sorghum bicolor] gi|241932350|gb|EES05495.1| hypothetical protein SORBIDRAFT_04g027355 [Sorghum bicolor] Length = 457 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = +2 Query: 2 IHTKKRNRLDSERLSSLVYVQFNSKPINKNKKVQDK--CDSLLANDSRMAQEWIVEGGDD 175 IHTKKRNRL + RL+ LVY+ FNSK +NK +K++ K D LL+ND+ AQ ++ E GDD Sbjct: 350 IHTKKRNRLTTTRLNKLVYIHFNSKLLNKREKIKSKKISDVLLSNDTTEAQGFLHENGDD 409 >ref|XP_002457467.1| hypothetical protein SORBIDRAFT_03g007660 [Sorghum bicolor] gi|241929442|gb|EES02587.1| hypothetical protein SORBIDRAFT_03g007660 [Sorghum bicolor] Length = 361 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/60 (55%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = +2 Query: 2 IHTKKRNRLDSERLSSLVYVQFNSKPINKNKKVQDK--CDSLLANDSRMAQEWIVEGGDD 175 IHTKKRNRL + RL+ LVY+QFNSK ++K +K++ K D LL++D+ AQ ++ EGGDD Sbjct: 232 IHTKKRNRLTTARLNKLVYIQFNSKLLSKKEKIKSKKIIDVLLSSDTCEAQGFLQEGGDD 291