BLASTX nr result
ID: Cnidium21_contig00018691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018691 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271611.2| PREDICTED: CTD small phosphatase-like protei... 67 2e-09 ref|XP_002514919.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_003601789.1| CTD small phosphatase-like protein [Medicago... 62 4e-08 ref|XP_004159546.1| PREDICTED: CTD small phosphatase-like protei... 61 8e-08 ref|XP_004143041.1| PREDICTED: uncharacterized protein LOC101204... 61 8e-08 >ref|XP_002271611.2| PREDICTED: CTD small phosphatase-like protein 2-like [Vitis vinifera] gi|297738449|emb|CBI27650.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -2 Query: 182 MQTKKKVPTRSSARELVSPKVSRHQKKASENVQLQERKANELITSSARKQR 30 MQTKKK+P R+SARE +P+VSR QKK SE VQ++E+K E+I SS R+QR Sbjct: 1 MQTKKKMPGRNSAREHANPRVSRSQKKVSETVQIKEQKVTEIIASSTRRQR 51 >ref|XP_002514919.1| conserved hypothetical protein [Ricinus communis] gi|223545970|gb|EEF47473.1| conserved hypothetical protein [Ricinus communis] Length = 455 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/51 (60%), Positives = 42/51 (82%) Frame = -2 Query: 182 MQTKKKVPTRSSARELVSPKVSRHQKKASENVQLQERKANELITSSARKQR 30 MQTKKK+ R+++RE +P++SR QKKAS+NVQ ++K +LITSSARKQR Sbjct: 1 MQTKKKLAGRNASREHGTPRISRAQKKASDNVQAGQKKVTDLITSSARKQR 51 >ref|XP_003601789.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355490837|gb|AES72040.1| CTD small phosphatase-like protein [Medicago truncatula] Length = 885 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -2 Query: 182 MQTKKKVPTRSSARELVSPKVSRHQKKASENVQLQERKANELITSSARKQRVP 24 MQTKKK R+ +RE SPKVSR QKKAS++ Q+ E+K +LITSSARK + P Sbjct: 1 MQTKKKASRRNGSRECTSPKVSRAQKKASDHSQVVEKKVADLITSSARKIKPP 53 >ref|XP_004159546.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis sativus] Length = 446 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%) Frame = -2 Query: 182 MQTKKKVPTRSSARELVSPKVSRHQKKASENVQLQERKANELITSSARKQRV----PKKS 15 MQTKKK R++ RELVSPKV R Q+K SE +Q+ E+ +ELITSSARK+ V KK+ Sbjct: 1 MQTKKKSHGRNTGRELVSPKVLRSQRKYSETLQVVEKNISELITSSARKRTVGCFPSKKN 60 Query: 14 VEHV 3 E V Sbjct: 61 EEDV 64 >ref|XP_004143041.1| PREDICTED: uncharacterized protein LOC101204959 [Cucumis sativus] Length = 1024 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%) Frame = -2 Query: 182 MQTKKKVPTRSSARELVSPKVSRHQKKASENVQLQERKANELITSSARKQRV----PKKS 15 MQTKKK R++ RELVSPKV R Q+K SE +Q+ E+ +ELITSSARK+ V KK+ Sbjct: 1 MQTKKKSHGRNTGRELVSPKVLRSQRKYSETLQVVEKNISELITSSARKRTVGCFPSKKN 60 Query: 14 VEHV 3 E V Sbjct: 61 EEDV 64