BLASTX nr result
ID: Cnidium21_contig00018396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018396 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631300.1| PREDICTED: ubiquitin-like-specific protease ... 81 3e-19 emb|CBI32142.3| unnamed protein product [Vitis vinifera] 81 3e-19 ref|XP_002525356.1| sentrin/sumo-specific protease, putative [Ri... 77 6e-17 gb|ADN33839.1| sentrin/sumo-specific protease [Cucumis melo subs... 72 5e-16 ref|XP_004135242.1| PREDICTED: ubiquitin-like-specific protease ... 72 5e-16 >ref|XP_003631300.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Vitis vinifera] Length = 304 Score = 81.3 bits (199), Expect(2) = 3e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 467 PQRIEEKVLMVPQQKNDYDCGLFVLFFIRRFIEDAPQRLKKKD 339 P+RIEEKV+ VPQQKNDYDCGLFVLFF+ RFIE+AP+RLKKKD Sbjct: 143 PRRIEEKVIAVPQQKNDYDCGLFVLFFMERFIEEAPERLKKKD 185 Score = 38.5 bits (88), Expect(2) = 3e-19 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 243 ARFGKQWFSPKEASDLRLEIRGSLKK 166 A FGKQWF P+EAS LR++IR L K Sbjct: 187 AMFGKQWFKPEEASGLRVKIRNLLMK 212 >emb|CBI32142.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 81.3 bits (199), Expect(2) = 3e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 467 PQRIEEKVLMVPQQKNDYDCGLFVLFFIRRFIEDAPQRLKKKD 339 P+RIEEKV+ VPQQKNDYDCGLFVLFF+ RFIE+AP+RLKKKD Sbjct: 143 PRRIEEKVIAVPQQKNDYDCGLFVLFFMERFIEEAPERLKKKD 185 Score = 38.5 bits (88), Expect(2) = 3e-19 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 243 ARFGKQWFSPKEASDLRLEIRGSLKK 166 A FGKQWF P+EAS LR++IR L K Sbjct: 187 AMFGKQWFKPEEASGLRVKIRNLLMK 212 >ref|XP_002525356.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223535319|gb|EEF36994.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 283 Score = 77.4 bits (189), Expect(2) = 6e-17 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 467 PQRIEEKVLMVPQQKNDYDCGLFVLFFIRRFIEDAPQRLKKKD 339 P+RIEEK + VPQQKNDYDCGLFVL+F+ RFIE+AP+RLKKKD Sbjct: 190 PRRIEEKKIEVPQQKNDYDCGLFVLYFMERFIEEAPERLKKKD 232 Score = 34.7 bits (78), Expect(2) = 6e-17 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 243 ARFGKQWFSPKEASDLRLEIRGSLKKMF 160 A FGK+WF P+EAS LR++IR L F Sbjct: 234 AMFGKRWFRPEEASGLRVKIRKLLLDEF 261 >gb|ADN33839.1| sentrin/sumo-specific protease [Cucumis melo subsp. melo] Length = 445 Score = 72.4 bits (176), Expect(2) = 5e-16 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 464 QRIEEKVLMVPQQKNDYDCGLFVLFFIRRFIEDAPQRLKKKD 339 +RIEEK++ VPQQKND DCGLFVL+FI RFIE+AP RLK+KD Sbjct: 352 RRIEEKIIEVPQQKNDCDCGLFVLYFIERFIEEAPDRLKRKD 393 Score = 36.6 bits (83), Expect(2) = 5e-16 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -3 Query: 237 FGKQWFSPKEASDLRLEIRGSLKKMFMDNR 148 FGK+WF P+EAS LR +IR LK F + + Sbjct: 397 FGKRWFKPQEASSLRTKIRCLLKVEFQNEK 426 >ref|XP_004135242.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Cucumis sativus] Length = 440 Score = 72.4 bits (176), Expect(2) = 5e-16 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 464 QRIEEKVLMVPQQKNDYDCGLFVLFFIRRFIEDAPQRLKKKD 339 +RIEEK++ VPQQKND DCGLFVL+FI RFIE+AP RLK+KD Sbjct: 347 RRIEEKIIEVPQQKNDCDCGLFVLYFIERFIEEAPDRLKRKD 388 Score = 36.6 bits (83), Expect(2) = 5e-16 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -3 Query: 237 FGKQWFSPKEASDLRLEIRGSLKKMFMDNR 148 FGK+WF P+EAS LR +IR LK F + + Sbjct: 392 FGKRWFKPQEASSLRTKIRCLLKVEFQNEK 421