BLASTX nr result
ID: Cnidium21_contig00018381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018381 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514773.1| leucine zipper-ef-hand containing transmembr... 85 7e-15 ref|XP_003524999.1| PREDICTED: LETM1 and EF-hand domain-containi... 83 3e-14 ref|XP_003531271.1| PREDICTED: LETM1 and EF-hand domain-containi... 82 3e-14 ref|XP_002275474.1| PREDICTED: LETM1 and EF-hand domain-containi... 82 3e-14 ref|XP_003635110.1| PREDICTED: LETM1 and EF-hand domain-containi... 82 4e-14 >ref|XP_002514773.1| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis] gi|223545824|gb|EEF47327.1| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis] Length = 758 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 502 IGDRWRLLDKDYDGKVSPEEVASAAMYLKDTLDKEGIQELISN 374 IGDRWRLLD+DYDGKV+PEEVASAAMYLKD LDKEGIQELISN Sbjct: 683 IGDRWRLLDRDYDGKVTPEEVASAAMYLKDHLDKEGIQELISN 725 >ref|XP_003524999.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Glycine max] Length = 736 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 502 IGDRWRLLDKDYDGKVSPEEVASAAMYLKDTLDKEGIQELISN 374 IGDRWRLLD+DYDGKV+PEEVASAAMYLKDTL KEGIQELIS+ Sbjct: 659 IGDRWRLLDRDYDGKVTPEEVASAAMYLKDTLGKEGIQELISS 701 >ref|XP_003531271.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Glycine max] Length = 738 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 502 IGDRWRLLDKDYDGKVSPEEVASAAMYLKDTLDKEGIQELISN 374 IGDRWRLLD+DYDGKV+PEEVASAAMYLKDTL KEGIQEL+S+ Sbjct: 660 IGDRWRLLDRDYDGKVTPEEVASAAMYLKDTLGKEGIQELVSS 702 >ref|XP_002275474.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] gi|296084337|emb|CBI24725.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 502 IGDRWRLLDKDYDGKVSPEEVASAAMYLKDTLDKEGIQELISN 374 IGDRWRLLD+DYDGKV+PEEVA+AA+YLKDTL KEGIQELISN Sbjct: 690 IGDRWRLLDRDYDGKVTPEEVAAAALYLKDTLGKEGIQELISN 732 >ref|XP_003635110.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Vitis vinifera] Length = 504 Score = 82.0 bits (201), Expect = 4e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -2 Query: 502 IGDRWRLLDKDYDGKVSPEEVASAAMYLKDTLDKEGIQELISN 374 IGDRWRLLD+DYDGKV+PEEVASA MYLKDTL K+GIQELISN Sbjct: 430 IGDRWRLLDRDYDGKVTPEEVASATMYLKDTLGKDGIQELISN 472