BLASTX nr result
ID: Cnidium21_contig00018364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018364 (688 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus com... 109 6e-22 ref|XP_002297994.1| cation proton exchanger [Populus trichocarpa... 108 8e-22 ref|XP_004164366.1| PREDICTED: cation/H(+) antiporter 18-like [C... 103 2e-20 ref|XP_004146576.1| PREDICTED: cation/H(+) antiporter 18-like [C... 103 2e-20 emb|CBI34425.3| unnamed protein product [Vitis vinifera] 103 2e-20 >ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549793|gb|EEF51281.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 109 bits (272), Expect = 6e-22 Identities = 53/63 (84%), Positives = 59/63 (93%) Frame = +3 Query: 3 RKSSNTQLRILACFHSSRSIPSIINLLEASRGIDKREGLCVYAMHLMELSERSSAILMIH 182 RK+S+ QLRILACFHS+R+IPS INLLEASRG+ K EGLCVYAMHLMELSERSSAILM+H Sbjct: 449 RKNSSMQLRILACFHSARNIPSTINLLEASRGVQKAEGLCVYAMHLMELSERSSAILMVH 508 Query: 183 KAR 191 KAR Sbjct: 509 KAR 511 >ref|XP_002297994.1| cation proton exchanger [Populus trichocarpa] gi|222845252|gb|EEE82799.1| cation proton exchanger [Populus trichocarpa] Length = 804 Score = 108 bits (271), Expect = 8e-22 Identities = 52/63 (82%), Positives = 59/63 (93%) Frame = +3 Query: 3 RKSSNTQLRILACFHSSRSIPSIINLLEASRGIDKREGLCVYAMHLMELSERSSAILMIH 182 R+SSNT+LRILACFH SR+I SIINLLE SRG++K EGLCVYAMHLMELSER+SAILM+H Sbjct: 448 RRSSNTELRILACFHGSRNISSIINLLEVSRGVEKAEGLCVYAMHLMELSERTSAILMVH 507 Query: 183 KAR 191 KAR Sbjct: 508 KAR 510 >ref|XP_004164366.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus] Length = 799 Score = 103 bits (258), Expect = 2e-20 Identities = 50/63 (79%), Positives = 57/63 (90%) Frame = +3 Query: 3 RKSSNTQLRILACFHSSRSIPSIINLLEASRGIDKREGLCVYAMHLMELSERSSAILMIH 182 RK+ NTQLR+L CFHS+ ++PSIINLLEASRG +K E LCVYAMHLMELSERSSAILM+H Sbjct: 448 RKNKNTQLRMLTCFHSAGNVPSIINLLEASRGTEKGEELCVYAMHLMELSERSSAILMVH 507 Query: 183 KAR 191 KAR Sbjct: 508 KAR 510 >ref|XP_004146576.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus] Length = 799 Score = 103 bits (258), Expect = 2e-20 Identities = 50/63 (79%), Positives = 57/63 (90%) Frame = +3 Query: 3 RKSSNTQLRILACFHSSRSIPSIINLLEASRGIDKREGLCVYAMHLMELSERSSAILMIH 182 RK+ NTQLR+L CFHS+ ++PSIINLLEASRG +K E LCVYAMHLMELSERSSAILM+H Sbjct: 448 RKNKNTQLRMLTCFHSAGNVPSIINLLEASRGTEKGEELCVYAMHLMELSERSSAILMVH 507 Query: 183 KAR 191 KAR Sbjct: 508 KAR 510 >emb|CBI34425.3| unnamed protein product [Vitis vinifera] Length = 774 Score = 103 bits (258), Expect = 2e-20 Identities = 51/63 (80%), Positives = 56/63 (88%) Frame = +3 Query: 3 RKSSNTQLRILACFHSSRSIPSIINLLEASRGIDKREGLCVYAMHLMELSERSSAILMIH 182 RK+ N +LRIL CF SS SIP+IINL+EASRG KREGLCVYAMHLMELSERSSAILM+H Sbjct: 444 RKNPNAELRILVCFQSSNSIPTIINLVEASRGTAKREGLCVYAMHLMELSERSSAILMVH 503 Query: 183 KAR 191 KAR Sbjct: 504 KAR 506