BLASTX nr result
ID: Cnidium21_contig00018250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018250 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containi... 61 7e-09 ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 emb|CBI15328.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002866406.1| pentatricopeptide repeat-containing protein ... 59 4e-07 gb|AAM63453.1| unknown [Arabidopsis thaliana] 59 4e-07 >ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Glycine max] Length = 509 Score = 61.2 bits (147), Expect(2) = 7e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 282 QRLDLSYSHVDLTPALILSTLNLSPNAGRSILGFLKWVSSRSNF 413 QRL+LS+SH+ TP LIL TLNLSP AGR++LGF +W+SS F Sbjct: 87 QRLNLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQF 130 Score = 23.5 bits (49), Expect(2) = 7e-09 Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +1 Query: 166 SPLNPSPLHPQFKKTHYH--TLF 228 SP++ SPL P+ +H++ TLF Sbjct: 25 SPIHHSPLFPRHSSSHFYSRTLF 47 >ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Vitis vinifera] Length = 516 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 282 QRLDLSYSHVDLTPALILSTLNLSPNAGRSILGFLKWVSSRSNF 413 QRL LS+SH+ +P LIL TLN SP+AGR++LGF KW+SS F Sbjct: 94 QRLQLSFSHITPSPPLILQTLNTSPDAGRTVLGFYKWLSSNPKF 137 >emb|CBI15328.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 282 QRLDLSYSHVDLTPALILSTLNLSPNAGRSILGFLKWVSSRSNF 413 QRL LS+SH+ +P LIL TLN SP+AGR++LGF KW+SS F Sbjct: 110 QRLQLSFSHITPSPPLILQTLNTSPDAGRTVLGFYKWLSSNPKF 153 >ref|XP_002866406.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312241|gb|EFH42665.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 522 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +3 Query: 282 QRLDLSYSHVDLTPALILSTLNLSPNAGRSILGFLKWVSSRSNF 413 QR +LS+SH+ P LIL TLNLSP AGR+ LGF +W+ S SNF Sbjct: 97 QRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNF 140 >gb|AAM63453.1| unknown [Arabidopsis thaliana] Length = 521 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +3 Query: 282 QRLDLSYSHVDLTPALILSTLNLSPNAGRSILGFLKWVSSRSNF 413 QR +LS+SH+ P LIL TLNLSP AGR+ LGF +W+ S SNF Sbjct: 96 QRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNF 139