BLASTX nr result
ID: Cnidium21_contig00018187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018187 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535575.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002535575.1| conserved hypothetical protein [Ricinus communis] gi|223522629|gb|EEF26808.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/87 (33%), Positives = 43/87 (49%) Frame = +1 Query: 7 GSGDGIDVLSFPWLPCDVNPPYVTLSHPGLIGCQARNLMKVNQHGWDEDLVRDLFTDRES 186 G G+ I V+ WLP DVN T + + + M+ + W+ L+ +F DR+ Sbjct: 40 GHGENISVIKDAWLPSDVNLKITTEVKDKNVDLKEVDFMQTWELRWNMQLINGIFNDRDK 99 Query: 187 QLILNIPLSSSVVINNWF*KKERSGFY 267 LILNIPLS N+ + K+ G Y Sbjct: 100 NLILNIPLSLRNTTNSLYWVKDEKGIY 126