BLASTX nr result
ID: Cnidium21_contig00018078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00018078 (935 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519846.1| conserved hypothetical protein [Ricinus comm... 67 6e-09 ref|XP_002326508.1| predicted protein [Populus trichocarpa] gi|1... 62 2e-07 ref|XP_003517375.1| PREDICTED: uncharacterized protein LOC100789... 59 2e-06 ref|XP_002526523.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 ref|XP_003524719.1| PREDICTED: uncharacterized protein LOC100500... 57 6e-06 >ref|XP_002519846.1| conserved hypothetical protein [Ricinus communis] gi|223540892|gb|EEF42450.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 67.0 bits (162), Expect = 6e-09 Identities = 36/79 (45%), Positives = 54/79 (68%) Frame = +1 Query: 139 MDKKQSGKEAAEELTRESLIAISYSVPDKDNSQDLPFPNKGSYNEVADISDEKAEKIRSE 318 MD K++ K+A+++L RESLI ISYS+P+K + P+ G + D++++ A++ RSE Sbjct: 1 MDIKEACKQASQDLARESLIEISYSLPEK-----VQTPDVGEISVGEDMNNDGADRFRSE 55 Query: 319 LISISYEELPDIKTPPVCS 375 LISISY + PDI PV S Sbjct: 56 LISISYSQSPDITLSPVSS 74 >ref|XP_002326508.1| predicted protein [Populus trichocarpa] gi|118485279|gb|ABK94499.1| unknown [Populus trichocarpa] gi|222833830|gb|EEE72307.1| predicted protein [Populus trichocarpa] Length = 84 Score = 62.0 bits (149), Expect = 2e-07 Identities = 38/80 (47%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = +1 Query: 139 MDKKQSGKEAAEELTRESLIAISYSVPDK-DNSQDLPFPNKGSYNEVADISDEKAEKIRS 315 MD K + +E ++EL RESLI ISY +PDK NS+ +P + ++ I+ + AEK RS Sbjct: 1 MDNKAACEEISQELARESLIGISYCLPDKVQNSEGVP-QSVNDEEKLPVINGDGAEKYRS 59 Query: 316 ELISISYEELPDIKTPPVCS 375 ELISIS + PD T PV S Sbjct: 60 ELISISDIQSPDTATSPVAS 79 >ref|XP_003517375.1| PREDICTED: uncharacterized protein LOC100789970 [Glycine max] Length = 73 Score = 58.9 bits (141), Expect = 2e-06 Identities = 35/73 (47%), Positives = 43/73 (58%) Frame = +1 Query: 139 MDKKQSGKEAAEELTRESLIAISYSVPDKDNSQDLPFPNKGSYNEVADISDEKAEKIRSE 318 MD K +A+EEL RE LIAIS S+PDK D P + A + + +K RSE Sbjct: 1 MDNKSPSNKASEELARELLIAISDSLPDKTLDSDF-VPESKDADSFARPNGDWDDKFRSE 59 Query: 319 LISISYEELPDIK 357 LISISY E PD+K Sbjct: 60 LISISYVESPDVK 72 >ref|XP_002526523.1| conserved hypothetical protein [Ricinus communis] gi|223534198|gb|EEF35914.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 58.5 bits (140), Expect = 2e-06 Identities = 36/77 (46%), Positives = 48/77 (62%) Frame = +1 Query: 139 MDKKQSGKEAAEELTRESLIAISYSVPDKDNSQDLPFPNKGSYNEVADISDEKAEKIRSE 318 MDK + GK+ EE+TRESLIAISYSVPDK + L N S ++ + ++A+ R E Sbjct: 1 MDKIEPGKDTPEEVTRESLIAISYSVPDKTLASKLLSENLES-KKLVKVDCDEADNYRWE 59 Query: 319 LISISYEELPDIKTPPV 369 L+SIS DI+ PV Sbjct: 60 LLSISNSPSLDIQGLPV 76 >ref|XP_003524719.1| PREDICTED: uncharacterized protein LOC100500280 [Glycine max] gi|255629926|gb|ACU15315.1| unknown [Glycine max] Length = 72 Score = 57.0 bits (136), Expect = 6e-06 Identities = 38/73 (52%), Positives = 46/73 (63%) Frame = +1 Query: 139 MDKKQSGKEAAEELTRESLIAISYSVPDKDNSQDLPFPNKGSYNEVADISDEKAEKIRSE 318 MD K KE+ EE TRESLIAIS S+PDK +K S + VA + ++ +K RSE Sbjct: 1 MDNKSPSKESKEE-TRESLIAISNSLPDKTLESKSALESKKS-DGVAMQNRDQDDKFRSE 58 Query: 319 LISISYEELPDIK 357 LISISY E PD K Sbjct: 59 LISISYAESPDEK 71