BLASTX nr result
ID: Cnidium21_contig00017959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017959 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P37399.1|ATPBM_DAUCA RecName: Full=ATP synthase subunit beta,... 80 2e-13 emb|CAH59403.1| mitochondrial F0 ATP synthase beta chain [Planta... 75 7e-12 ref|XP_003555932.1| PREDICTED: ATP synthase subunit beta, mitoch... 75 7e-12 ref|XP_004150673.1| PREDICTED: ATP synthase subunit beta, mitoch... 74 1e-11 sp|P43395.1|ATPBM_ACTDE RecName: Full=ATP synthase subunit beta,... 74 1e-11 >sp|P37399.1|ATPBM_DAUCA RecName: Full=ATP synthase subunit beta, mitochondrial; Flags: Precursor gi|18322|emb|CAA42844.1| ATP synthase b subunit [Daucus carota] Length = 547 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 275 CITSFQGVLDGKYDDLPEQAFYMLGGIEDVIAKAEKIDKEN 153 C+TSFQGVLDGKYDDLPEQ+FYMLGGIE+VIAKAEK+ KEN Sbjct: 505 CVTSFQGVLDGKYDDLPEQSFYMLGGIEEVIAKAEKMAKEN 545 >emb|CAH59403.1| mitochondrial F0 ATP synthase beta chain [Plantago major] Length = 188 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 272 ITSFQGVLDGKYDDLPEQAFYMLGGIEDVIAKAEKIDKEN 153 ITSFQGVLDGKYDDLPEQ+FYM+GGIE+V+AKAEKI KE+ Sbjct: 148 ITSFQGVLDGKYDDLPEQSFYMVGGIEEVLAKAEKISKES 187 >ref|XP_003555932.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Glycine max] Length = 559 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 272 ITSFQGVLDGKYDDLPEQAFYMLGGIEDVIAKAEKIDKEN 153 ITSFQGVLDGKYDDLPEQ+FYM+GGIE+VIAKAEKI KE+ Sbjct: 517 ITSFQGVLDGKYDDLPEQSFYMVGGIEEVIAKAEKIAKES 556 >ref|XP_004150673.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Cucumis sativus] gi|449519398|ref|XP_004166722.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Cucumis sativus] Length = 560 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 272 ITSFQGVLDGKYDDLPEQAFYMLGGIEDVIAKAEKIDKEN 153 ITSFQGVLDGKYDDLPEQ+FYM+GGIE+VIAKAEKI +E+ Sbjct: 519 ITSFQGVLDGKYDDLPEQSFYMIGGIEEVIAKAEKIARES 558 >sp|P43395.1|ATPBM_ACTDE RecName: Full=ATP synthase subunit beta, mitochondrial gi|1085656|pir||S48039 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain, mitochondrial - kiwi fruit (fragment) gi|450243|gb|AAA53073.1| beta subunit of ATP synthase, partial [Actinidia deliciosa] Length = 173 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -3 Query: 272 ITSFQGVLDGKYDDLPEQAFYMLGGIEDVIAKAEKIDKEN 153 ITSFQGVLDGK+DDLPEQ+FYM+GGIE+VIAKAEKI KE+ Sbjct: 132 ITSFQGVLDGKFDDLPEQSFYMVGGIEEVIAKAEKISKES 171