BLASTX nr result
ID: Cnidium21_contig00017920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017920 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB52070.1| putative zeta carotene desaturase [Daucus carota ... 70 1e-10 gb|ABB52083.1| zeta carotene desaturase [Daucus carota subsp. sa... 66 3e-09 gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas] 60 2e-07 ref|XP_002328354.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >gb|ABB52070.1| putative zeta carotene desaturase [Daucus carota subsp. sativus] Length = 575 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 431 LSGRQASAYICDAGEDLVALQKKIASIESNSPTEAELSLV 312 LSGRQASAYICDAGEDLVALQKKI IESN+PT AELSLV Sbjct: 536 LSGRQASAYICDAGEDLVALQKKIGVIESNTPTGAELSLV 575 >gb|ABB52083.1| zeta carotene desaturase [Daucus carota subsp. sativus] Length = 573 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 431 LSGRQASAYICDAGEDLVALQKKIASIESNSPTEAELSLV 312 LSGRQASAYICDAGE+L L+K IASI+SN+PTEAEL+LV Sbjct: 534 LSGRQASAYICDAGEELTTLRKTIASIDSNTPTEAELTLV 573 >gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas] Length = 586 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 5/45 (11%) Frame = -1 Query: 431 LSGRQASAYICDAGEDLVALQKKIASIES-----NSPTEAELSLV 312 LSGRQASAYICDAGEDLVAL+KK+A+IES +SP ELSLV Sbjct: 542 LSGRQASAYICDAGEDLVALRKKLAAIESPEIGPSSPVTDELSLV 586 >ref|XP_002328354.1| predicted protein [Populus trichocarpa] gi|222838069|gb|EEE76434.1| predicted protein [Populus trichocarpa] Length = 530 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 5/45 (11%) Frame = -1 Query: 431 LSGRQASAYICDAGEDLVALQKKIASIES----NSPTEA-ELSLV 312 LSGRQASAYICDAGE+LVAL+KK+A++ES NS T ELSLV Sbjct: 486 LSGRQASAYICDAGEELVALRKKLAAVESQDCANSNTVTDELSLV 530