BLASTX nr result
ID: Cnidium21_contig00017761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017761 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betul... 72 4e-11 gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis] 71 8e-11 gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Be... 70 1e-10 emb|CAD21844.1| ACC oxidase 1 [Fagus sylvatica] 70 2e-10 gb|AAB05171.1| ACC oxidase [Nicotiana glutinosa] 70 2e-10 >emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betula pendula] Length = 318 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/46 (82%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +3 Query: 6 LLEKE-EKGHPYPKFVFQDYMKVYAGLKFQAKEPRFEAMKKAMEIT 140 L+EKE EKG YPKFVF+DYMK+YAGLKFQAKEPRFEAM KAME T Sbjct: 265 LVEKEAEKGQVYPKFVFEDYMKLYAGLKFQAKEPRFEAM-KAMEST 309 >gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis] Length = 317 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 6 LLEKEEKGHPYPKFVFQDYMKVYAGLKFQAKEPRFEAMKKAME 134 L+EKEE+ YPKFVF+DYMK+YAGLKFQAKEPRFEAM KAME Sbjct: 265 LVEKEEQKQVYPKFVFEDYMKLYAGLKFQAKEPRFEAM-KAME 306 >gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Betula luminifera] Length = 318 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +3 Query: 6 LLEKE-EKGHPYPKFVFQDYMKVYAGLKFQAKEPRFEAMK 122 L+EKE EKG YPKFVF+DYMK+YAGLKFQAKEPRFEAMK Sbjct: 265 LVEKEAEKGQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMK 304 >emb|CAD21844.1| ACC oxidase 1 [Fagus sylvatica] Length = 319 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +3 Query: 12 EKEEKGHPYPKFVFQDYMKVYAGLKFQAKEPRFEAMKKAMEITTV 146 E EEK + YPKFVF+DYMK+YAGLKFQAKEPRFEAMK TV Sbjct: 269 EAEEKNNVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESNVTV 313 >gb|AAB05171.1| ACC oxidase [Nicotiana glutinosa] Length = 320 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +3 Query: 6 LLEKEEKGHP--YPKFVFQDYMKVYAGLKFQAKEPRFEAMKKAMEIT 140 L EKEEK + YPKFVF+DYMK+YA LKFQAKEPRFEAM KAM+ T Sbjct: 265 LAEKEEKENKLKYPKFVFEDYMKLYAALKFQAKEPRFEAMNKAMKTT 311