BLASTX nr result
ID: Cnidium21_contig00017411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017411 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167895.1| PREDICTED: LOW QUALITY PROTEIN: phosphogluco... 68 7e-10 ref|XP_004150117.1| PREDICTED: phosphoglucomutase, cytoplasmic-l... 68 7e-10 ref|XP_002527783.1| phosphoglucomutase, putative [Ricinus commun... 68 7e-10 ref|XP_002311517.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 gb|AAR83345.1| cytosolic phosphoglucomutase [Populus tomentosa] 68 7e-10 >ref|XP_004167895.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucomutase, cytoplasmic-like [Cucumis sativus] Length = 582 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 471 DFGIKYNMENGGPAPVGITHKIYENTKTIKEYL 373 DFGIKYNMENGGPAP GIT KIYENTKTIKEYL Sbjct: 133 DFGIKYNMENGGPAPEGITDKIYENTKTIKEYL 165 >ref|XP_004150117.1| PREDICTED: phosphoglucomutase, cytoplasmic-like [Cucumis sativus] Length = 582 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 471 DFGIKYNMENGGPAPVGITHKIYENTKTIKEYL 373 DFGIKYNMENGGPAP GIT KIYENTKTIKEYL Sbjct: 133 DFGIKYNMENGGPAPEGITDKIYENTKTIKEYL 165 >ref|XP_002527783.1| phosphoglucomutase, putative [Ricinus communis] gi|223532818|gb|EEF34593.1| phosphoglucomutase, putative [Ricinus communis] Length = 581 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 471 DFGIKYNMENGGPAPVGITHKIYENTKTIKEYL 373 DFGIKYNMENGGPAP GIT KIYENTKTIKEYL Sbjct: 132 DFGIKYNMENGGPAPEGITDKIYENTKTIKEYL 164 >ref|XP_002311517.1| predicted protein [Populus trichocarpa] gi|222851337|gb|EEE88884.1| predicted protein [Populus trichocarpa] Length = 582 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 471 DFGIKYNMENGGPAPVGITHKIYENTKTIKEYL 373 DFGIKYNMENGGPAP GIT KIYENTKTIKEYL Sbjct: 133 DFGIKYNMENGGPAPEGITDKIYENTKTIKEYL 165 >gb|AAR83345.1| cytosolic phosphoglucomutase [Populus tomentosa] Length = 582 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 471 DFGIKYNMENGGPAPVGITHKIYENTKTIKEYL 373 DFGIKYNMENGGPAP GIT KIYENTKTIKEYL Sbjct: 133 DFGIKYNMENGGPAPEGITDKIYENTKTIKEYL 165