BLASTX nr result
ID: Cnidium21_contig00017346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017346 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519470.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 ref|XP_002316393.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|XP_002311069.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|NP_191048.1| uncharacterized protein [Arabidopsis thaliana] ... 67 1e-09 ref|XP_003633469.1| PREDICTED: uncharacterized protein LOC100854... 67 1e-09 >ref|XP_002519470.1| conserved hypothetical protein [Ricinus communis] gi|223541333|gb|EEF42884.1| conserved hypothetical protein [Ricinus communis] Length = 105 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +2 Query: 11 REKIMSWSTTYKELLSTIEPFKDPIPLAEMVESLVDIWLEEGLY 142 RE IMSW+ TY++LL + EPF+ PIPLAEMV+ LVDIW EEGLY Sbjct: 61 REPIMSWTATYEDLLCSSEPFQQPIPLAEMVDFLVDIWHEEGLY 104 >ref|XP_002316393.1| predicted protein [Populus trichocarpa] gi|222865433|gb|EEF02564.1| predicted protein [Populus trichocarpa] Length = 110 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +2 Query: 8 IREKIMSWSTTYKELLSTIEPFKDPIPLAEMVESLVDIWLEEGLY 142 I++ I+SWSTTY++LLST EPF +PIPL EMV+ LVDIW +EGL+ Sbjct: 65 IKDPIISWSTTYEDLLSTHEPFPEPIPLPEMVDFLVDIWHDEGLF 109 >ref|XP_002311069.1| predicted protein [Populus trichocarpa] gi|222850889|gb|EEE88436.1| predicted protein [Populus trichocarpa] Length = 110 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +2 Query: 11 REKIMSWSTTYKELLSTIEPFKDPIPLAEMVESLVDIWLEEGLY 142 ++ I+SWSTTY++LLST EPF +PIPL+EMV+ LVDIW +EGL+ Sbjct: 66 KDPIISWSTTYEDLLSTQEPFSEPIPLSEMVDFLVDIWHDEGLF 109 >ref|NP_191048.1| uncharacterized protein [Arabidopsis thaliana] gi|4678305|emb|CAB41096.1| putative protein [Arabidopsis thaliana] gi|37202074|gb|AAQ89652.1| At3g54880 [Arabidopsis thaliana] gi|51972035|dbj|BAD44682.1| putative protein [Arabidopsis thaliana] gi|332645783|gb|AEE79304.1| uncharacterized protein [Arabidopsis thaliana] Length = 112 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = +2 Query: 11 REKIMSWSTTYKELLSTIEPFKDPIPLAEMVESLVDIWLEEGLY 142 +++I+SWSTTY++LLST EPF + IPL EMV+ LVDIW +EGLY Sbjct: 68 KDQIISWSTTYEDLLSTHEPFSESIPLPEMVDFLVDIWYDEGLY 111 >ref|XP_003633469.1| PREDICTED: uncharacterized protein LOC100854399 [Vitis vinifera] Length = 111 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 11 REKIMSWSTTYKELLSTIEPFKDPIPLAEMVESLVDIWLEEGLY 142 ++ I+SWS TY++LLST EPF +PIPL EMV+ LVDIW +EGLY Sbjct: 67 KDPIISWSMTYEDLLSTNEPFSEPIPLTEMVDFLVDIWQDEGLY 110