BLASTX nr result
ID: Cnidium21_contig00017265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017265 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301088.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|XP_002514022.1| conserved hypothetical protein [Ricinus comm... 98 8e-19 ref|XP_002307345.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 ref|XP_002276277.2| PREDICTED: uncharacterized protein LOC100246... 95 5e-18 ref|XP_003559859.1| PREDICTED: uncharacterized protein LOC100828... 95 5e-18 >ref|XP_002301088.1| predicted protein [Populus trichocarpa] gi|222842814|gb|EEE80361.1| predicted protein [Populus trichocarpa] Length = 904 Score = 98.2 bits (243), Expect = 6e-19 Identities = 53/83 (63%), Positives = 62/83 (74%), Gaps = 1/83 (1%) Frame = -2 Query: 299 WKYEVNLLMRTYMSG-GGDPNVVPPKGSEANLTLGGIDLNSSGSVVVKADKKLLTVLFPD 123 WK +L RT + +P+ +P KGSE NLTLGGIDLN+SGSVVV+ADKKLLTVLFPD Sbjct: 48 WKKRWFILTRTSLVFFRSNPSAIPQKGSEVNLTLGGIDLNNSGSVVVRADKKLLTVLFPD 107 Query: 122 GRDGRAFTLKVQQGATSKS*RGW 54 GRDGRAFTLK + TS+ GW Sbjct: 108 GRDGRAFTLKAE---TSEDLYGW 127 >ref|XP_002514022.1| conserved hypothetical protein [Ricinus communis] gi|223547108|gb|EEF48605.1| conserved hypothetical protein [Ricinus communis] Length = 980 Score = 97.8 bits (242), Expect = 8e-19 Identities = 51/72 (70%), Positives = 57/72 (79%), Gaps = 1/72 (1%) Frame = -2 Query: 299 WKYEVNLLMRTYMSG-GGDPNVVPPKGSEANLTLGGIDLNSSGSVVVKADKKLLTVLFPD 123 WK +L RT + DP+ VP KGSE NLTLGGIDLN+SGSVVVK+DKKLLTVLFPD Sbjct: 66 WKKRWFILTRTSLVFFRSDPSAVPQKGSEVNLTLGGIDLNNSGSVVVKSDKKLLTVLFPD 125 Query: 122 GRDGRAFTLKVQ 87 GRDGRAFTLK + Sbjct: 126 GRDGRAFTLKAE 137 >ref|XP_002307345.1| predicted protein [Populus trichocarpa] gi|222856794|gb|EEE94341.1| predicted protein [Populus trichocarpa] Length = 857 Score = 97.1 bits (240), Expect = 1e-18 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 1/72 (1%) Frame = -2 Query: 299 WKYEVNLLMRTYMSG-GGDPNVVPPKGSEANLTLGGIDLNSSGSVVVKADKKLLTVLFPD 123 WK +L RT + DP+ +P KGSE NLTLGGIDLN+SGSVVVKA+KKLLTVLFPD Sbjct: 19 WKKRWFILTRTSLVFFRSDPSAIPQKGSEVNLTLGGIDLNNSGSVVVKAEKKLLTVLFPD 78 Query: 122 GRDGRAFTLKVQ 87 GRDGRAFTLK + Sbjct: 79 GRDGRAFTLKAE 90 >ref|XP_002276277.2| PREDICTED: uncharacterized protein LOC100246624 [Vitis vinifera] Length = 884 Score = 95.1 bits (235), Expect = 5e-18 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 1/83 (1%) Frame = -2 Query: 299 WKYEVNLLMRTYMSG-GGDPNVVPPKGSEANLTLGGIDLNSSGSVVVKADKKLLTVLFPD 123 WK +L RT + DPN +P +G E NLTLGGIDLN+SGSVVV+ DKKLLTVLFPD Sbjct: 37 WKKRWFILTRTSLVFFKSDPNALPQRGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPD 96 Query: 122 GRDGRAFTLKVQQGATSKS*RGW 54 GRDGRAFTLK + +S+ GW Sbjct: 97 GRDGRAFTLKAE---SSEDLYGW 116 >ref|XP_003559859.1| PREDICTED: uncharacterized protein LOC100828242 [Brachypodium distachyon] Length = 861 Score = 95.1 bits (235), Expect = 5e-18 Identities = 49/72 (68%), Positives = 55/72 (76%), Gaps = 1/72 (1%) Frame = -2 Query: 299 WKYEVNLLMRTYMSG-GGDPNVVPPKGSEANLTLGGIDLNSSGSVVVKADKKLLTVLFPD 123 WK +L RT + DPN +P +G E NLTLGGIDLNSSGSVVV+ DKKLLTVLFPD Sbjct: 46 WKKRWFILTRTSLVFFKSDPNTLPQRGGEVNLTLGGIDLNSSGSVVVREDKKLLTVLFPD 105 Query: 122 GRDGRAFTLKVQ 87 GRDGRAFTLK + Sbjct: 106 GRDGRAFTLKAE 117