BLASTX nr result
ID: Cnidium21_contig00017196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017196 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] 87 1e-15 gb|ADZ28107.1| ethylene response factor 4 [Malus x domestica] 62 4e-08 gb|ADE41144.1| AP2 domain class transcription factor [Malus x do... 62 4e-08 gb|ADD09598.1| dehydration responsive element binding protein [T... 59 5e-07 ref|XP_002533146.1| DNA binding protein, putative [Ricinus commu... 59 5e-07 >dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] Length = 320 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 279 GSSPESEITFLDFSEPSFDESENFMLQKFPSVEIDWEALASSLMS 145 GSSPESEI+FLDFSEP FDESENFMLQKFPSVEIDWEAL SSLMS Sbjct: 276 GSSPESEISFLDFSEPCFDESENFMLQKFPSVEIDWEALTSSLMS 320 >gb|ADZ28107.1| ethylene response factor 4 [Malus x domestica] Length = 323 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 276 SSPESEITFLDFSEPSFDESENFMLQKFPSVEIDWEAL 163 SSPES+ITFLDFS+ +DE+ENF L+K+PSVEIDW A+ Sbjct: 286 SSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI 323 >gb|ADE41144.1| AP2 domain class transcription factor [Malus x domestica] Length = 323 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 276 SSPESEITFLDFSEPSFDESENFMLQKFPSVEIDWEAL 163 SSPES+ITFLDFS+ +DE+ENF L+K+PSVEIDW A+ Sbjct: 286 SSPESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI 323 >gb|ADD09598.1| dehydration responsive element binding protein [Trifolium repens] Length = 304 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -3 Query: 276 SSPESEITFLDFSEPS-FDESENFMLQKFPSVEIDWEAL 163 SSPES +TFLDFS+ S +DE ENF L+K+PSVEIDWEAL Sbjct: 266 SSPESGVTFLDFSDSSHWDEVENFGLKKYPSVEIDWEAL 304 >ref|XP_002533146.1| DNA binding protein, putative [Ricinus communis] gi|223527057|gb|EEF29242.1| DNA binding protein, putative [Ricinus communis] Length = 374 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/40 (70%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = -3 Query: 276 SSPESEITFLDFSEPS--FDESENFMLQKFPSVEIDWEAL 163 SSP+SEI+FLDFS+ S +DESENF L+K+PSVEIDW +L Sbjct: 335 SSPQSEISFLDFSDSSSQWDESENFCLEKYPSVEIDWASL 374