BLASTX nr result
ID: Cnidium21_contig00017053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017053 (865 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636900.1| RING finger and CHY zinc finger domain-conta... 60 5e-07 ref|XP_002309580.1| predicted protein [Populus trichocarpa] gi|1... 60 6e-07 ref|XP_003550153.1| PREDICTED: RING finger and CHY zinc finger d... 58 2e-06 ref|XP_003544630.1| PREDICTED: RING finger and CHY zinc finger d... 58 2e-06 ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger d... 58 2e-06 >ref|XP_003636900.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355502835|gb|AES84038.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Length = 301 Score = 60.5 bits (145), Expect = 5e-07 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +1 Query: 715 CCISNDTKESHPCIEGLIHRDCPICXXXXXXXXXXXXXMPCGHAIH 852 CC+S + +HPC+EG +HRDCP+C MPCGH IH Sbjct: 171 CCLSTQVENNHPCVEGAMHRDCPVCYEYIFESTKEIVVMPCGHTIH 216 >ref|XP_002309580.1| predicted protein [Populus trichocarpa] gi|118485648|gb|ABK94674.1| unknown [Populus trichocarpa] gi|222855556|gb|EEE93103.1| predicted protein [Populus trichocarpa] Length = 300 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/47 (46%), Positives = 27/47 (57%) Frame = +1 Query: 715 CCISNDTKESHPCIEGLIHRDCPICXXXXXXXXXXXXXMPCGHAIHD 855 CC SN K SHPC+EG +H DCP+C +PCGH IH+ Sbjct: 170 CCYSNLLKNSHPCVEGAMHHDCPVCFEFLFESRYDVTVLPCGHTIHE 216 >ref|XP_003550153.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Length = 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = +1 Query: 715 CCISNDTKESHPCIEGLIHRDCPICXXXXXXXXXXXXXMPCGHAIH 852 CC S K SHPC+EG +H DCP+C MPCGH IH Sbjct: 180 CCYSTLLKNSHPCVEGAMHHDCPVCFEYLFESRNDVTVMPCGHTIH 225 >ref|XP_003544630.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 2 [Glycine max] Length = 323 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = +1 Query: 715 CCISNDTKESHPCIEGLIHRDCPICXXXXXXXXXXXXXMPCGHAIH 852 CC S K SHPC+EG +H DCP+C MPCGH IH Sbjct: 195 CCYSTLLKNSHPCVEGAMHHDCPVCFEYLFESRNDVTVMPCGHTIH 240 >ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 1 [Glycine max] Length = 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = +1 Query: 715 CCISNDTKESHPCIEGLIHRDCPICXXXXXXXXXXXXXMPCGHAIH 852 CC S K SHPC+EG +H DCP+C MPCGH IH Sbjct: 180 CCYSTLLKNSHPCVEGAMHHDCPVCFEYLFESRNDVTVMPCGHTIH 225