BLASTX nr result
ID: Cnidium21_contig00017014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00017014 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144208.1| PREDICTED: uncharacterized protein LOC101209... 55 8e-06 >ref|XP_004144208.1| PREDICTED: uncharacterized protein LOC101209292 [Cucumis sativus] gi|449527370|ref|XP_004170684.1| PREDICTED: uncharacterized protein LOC101230452 [Cucumis sativus] Length = 396 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 13/73 (17%) Frame = +3 Query: 72 YIRHQNPSFSSTLLDQIYRSIDE-----TNDHK-----GTVKKKKHFIHTPDQDEADFQR 221 Y H+NPSFSSTLLD+IYRSID+ T + K TVKK DQ+ A+ +R Sbjct: 6 YYEHKNPSFSSTLLDEIYRSIDDGEKKPTGETKFYREISTVKKHIKTRAFEDQEMANLRR 65 Query: 222 ---IENWMEKRKG 251 IE WMEK+ G Sbjct: 66 ACMIEKWMEKKVG 78