BLASTX nr result
ID: Cnidium21_contig00016873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016873 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281657.1| PREDICTED: inositol-3-phosphate synthase [Vi... 72 5e-11 gb|AET81043.1| myo-inositol 1-phosphate synthase [Setaria italica] 71 8e-11 ref|NP_001105552.1| inositol-3-phosphate synthase [Zea mays] gi|... 71 8e-11 sp|O65195.1|INO1_HORVU RecName: Full=Inositol-3-phosphate syntha... 71 8e-11 dbj|BAA25729.1| myo-inositol phosphate synthase [Oryza sativa Ja... 71 8e-11 >ref|XP_002281657.1| PREDICTED: inositol-3-phosphate synthase [Vitis vinifera] gi|296082443|emb|CBI21448.3| unnamed protein product [Vitis vinifera] Length = 510 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 257 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 153 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 510 >gb|AET81043.1| myo-inositol 1-phosphate synthase [Setaria italica] Length = 510 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 257 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 153 TPVVNALAKQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510 >ref|NP_001105552.1| inositol-3-phosphate synthase [Zea mays] gi|11762100|gb|AAG40328.1| myo-inositol 1-phosphate synthase [Zea mays] gi|414865461|tpg|DAA44018.1| TPA: low phytic acid1 [Zea mays] Length = 510 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 257 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 153 TPVVNALAKQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510 >sp|O65195.1|INO1_HORVU RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|3152731|gb|AAC17133.1| myo-inositol 1-phosphate synthase [Hordeum vulgare subsp. vulgare] Length = 510 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 257 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 153 TPVVNALAKQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510 >dbj|BAA25729.1| myo-inositol phosphate synthase [Oryza sativa Japonica Group] Length = 510 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 257 TPVVNALAKQRAMLENILRACVGLAPENNMILEYK 153 TPVVNALAKQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510