BLASTX nr result
ID: Cnidium21_contig00016668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016668 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] 57 2e-06 ref|XP_004148530.1| PREDICTED: purple acid phosphatase 2-like [C... 55 5e-06 ref|XP_002306126.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] Length = 470 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -2 Query: 296 PRTFWFITPPAIGPDVPYTFGLIGKL 219 PRTFWF+TPP +GPDVPYTFGLIG L Sbjct: 145 PRTFWFVTPPQVGPDVPYTFGLIGDL 170 >ref|XP_004148530.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus] gi|449516387|ref|XP_004165228.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus] Length = 477 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -2 Query: 296 PRTFWFITPPAIGPDVPYTFGLIGKL 219 PRTFWF+TPP +GPDVPYTFG+IG L Sbjct: 152 PRTFWFVTPPEVGPDVPYTFGVIGDL 177 >ref|XP_002306126.1| predicted protein [Populus trichocarpa] gi|222849090|gb|EEE86637.1| predicted protein [Populus trichocarpa] Length = 468 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -2 Query: 293 RTFWFITPPAIGPDVPYTFGLIGKLLFLYAVSSLRLLNH 177 R FWFITPPA+GPDVPYTFGLIG L Y S R L H Sbjct: 144 RQFWFITPPAVGPDVPYTFGLIGDLGQTY--DSNRTLTH 180