BLASTX nr result
ID: Cnidium21_contig00016569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016569 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529408.1| Hydrophobic protein OSR8, putative [Ricinus ... 83 2e-14 ref|XP_002325125.1| stress-induced hydrophobic peptide [Populus ... 83 2e-14 gb|ABK94331.1| unknown [Populus trichocarpa] 83 2e-14 gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasi... 82 3e-14 ref|XP_003519155.1| PREDICTED: UPF0057 membrane protein At4g3066... 82 3e-14 >ref|XP_002529408.1| Hydrophobic protein OSR8, putative [Ricinus communis] gi|223531156|gb|EEF33004.1| Hydrophobic protein OSR8, putative [Ricinus communis] Length = 75 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 175 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNR 294 GVC RHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVFVNR Sbjct: 21 GVCLRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFVNR 60 >ref|XP_002325125.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|222866559|gb|EEF03690.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 54 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 175 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNR 294 GVCFRHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVF++R Sbjct: 14 GVCFRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFIDR 53 >gb|ABK94331.1| unknown [Populus trichocarpa] Length = 77 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 175 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNR 294 GVCFRHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVF++R Sbjct: 21 GVCFRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFIDR 60 >gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasiliensis] Length = 75 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 175 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNR 294 GVCFRHGCCSVEF ICLLLT+LGYVPGIIYALYAIVFV+R Sbjct: 21 GVCFRHGCCSVEFCICLLLTILGYVPGIIYALYAIVFVDR 60 >ref|XP_003519155.1| PREDICTED: UPF0057 membrane protein At4g30660 [Glycine max] gi|255628505|gb|ACU14597.1| unknown [Glycine max] Length = 75 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 175 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNR 294 GVCFRHGCCSVEF ICLLLT+LGY+PGIIYALYAI+FV+R Sbjct: 21 GVCFRHGCCSVEFIICLLLTILGYIPGIIYALYAIIFVDR 60