BLASTX nr result
ID: Cnidium21_contig00016460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016460 (740 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524810.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002274278.1| PREDICTED: uncharacterized protein LOC100259... 57 5e-06 >ref|XP_002524810.1| conserved hypothetical protein [Ricinus communis] gi|223535994|gb|EEF37653.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/62 (50%), Positives = 41/62 (66%) Frame = -1 Query: 524 KPLSNLDGGLEHESERMVYLDDQPTLSTARTEMKDRL*IIAEYYLSKHSPKWRKQSVLVP 345 KPL + G L S+ V+ D + L+ + TEMKD L I+AE+YLSK S W KQS+LVP Sbjct: 164 KPLVDFVGDLASSSKITVHPDGRVLLTGSGTEMKDILSIVAEFYLSKTSTTWTKQSMLVP 223 Query: 344 QF 339 +F Sbjct: 224 RF 225 >ref|XP_002274278.1| PREDICTED: uncharacterized protein LOC100259706 [Vitis vinifera] gi|296086692|emb|CBI32327.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 56.6 bits (135), Expect = 5e-06 Identities = 30/76 (39%), Positives = 46/76 (60%) Frame = -1 Query: 545 SAYFYFEKPLSNLDGGLEHESERMVYLDDQPTLSTARTEMKDRL*IIAEYYLSKHSPKWR 366 S+ + +KP + G L S+ +V+ D + + TEMKD L ++AE+YLSK+S K Sbjct: 171 SSELHAQKPFVDFVGDLARSSKLIVHPDGRVSFMGTGTEMKDLLSVVAEFYLSKNSTKHG 230 Query: 365 KQSVLVPQFDSLKNRE 318 KQS+LVP F L+ + Sbjct: 231 KQSLLVPHFTRLERAD 246