BLASTX nr result
ID: Cnidium21_contig00016274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016274 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280798.2| PREDICTED: cysteine proteinase RD19a-like [V... 70 2e-10 ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a isoform... 68 9e-10 dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus] 67 2e-09 emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [... 67 2e-09 dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense] 66 3e-09 >ref|XP_002280798.2| PREDICTED: cysteine proteinase RD19a-like [Vitis vinifera] gi|147841854|emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera] gi|302142582|emb|CBI19785.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 316 WGESWGEDGYYKICRGQTHDVCGVDSMVSTVAAFHST 206 WGESWGE GYYKICRG H++CGVDSMVSTVAA H+T Sbjct: 335 WGESWGEQGYYKICRG--HNICGVDSMVSTVAAIHTT 369 >ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a isoform 1 [Vitis vinifera] gi|297735094|emb|CBI17456.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 316 WGESWGEDGYYKICRGQTHDVCGVDSMVSTVAAFHST 206 WGESWGEDGYYKICRG H+ CGVDSMVSTVAA +T Sbjct: 331 WGESWGEDGYYKICRG--HNACGVDSMVSTVAAIQTT 365 >dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus] Length = 360 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 316 WGESWGEDGYYKICRGQTHDVCGVDSMVSTVAAFHST 206 WGE+WGE+GYYKICRG+ +VCGVDSMVSTVAA H+T Sbjct: 324 WGENWGENGYYKICRGR--NVCGVDSMVSTVAALHTT 358 >emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus] Length = 361 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 316 WGESWGEDGYYKICRGQTHDVCGVDSMVSTVAAFHST 206 WGE+WGE+GYYKICRG+ +VCGVDSMVSTVAA H+T Sbjct: 325 WGENWGENGYYKICRGR--NVCGVDSMVSTVAALHTT 359 >dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense] Length = 367 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 316 WGESWGEDGYYKICRGQTHDVCGVDSMVSTVAAFHST 206 WGE WGE GYYKICRGQ H++CGVD+MVSTV A H+T Sbjct: 328 WGEHWGEHGYYKICRGQ-HNICGVDAMVSTVTAAHTT 363