BLASTX nr result
ID: Cnidium21_contig00016104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016104 (769 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF87264.1|AC068562_11 EST gb|F14399 comes from this gene [Ar... 60 4e-07 ref|NP_564164.1| synaptonemal complex protein 2 [Arabidopsis tha... 60 4e-07 ref|NP_173645.3| synaptonemal complex protein 1 [Arabidopsis tha... 60 4e-07 ref|XP_002890507.1| hypothetical protein ARALYDRAFT_889731 [Arab... 59 1e-06 ref|XP_003543761.1| PREDICTED: synaptonemal complex protein 1-li... 59 1e-06 >gb|AAF87264.1|AC068562_11 EST gb|F14399 comes from this gene [Arabidopsis thaliana] Length = 1025 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 642 QELLVKAENNLAEAKKQHDQMLESKQLELSRHLKEISQK 758 +ELL AE LAEAKKQ+D MLESKQLELSRHLKE+SQ+ Sbjct: 665 KELLATAETKLAEAKKQYDLMLESKQLELSRHLKELSQR 703 >ref|NP_564164.1| synaptonemal complex protein 2 [Arabidopsis thaliana] gi|47606231|sp|P61430.1|SYCP2_ARATH RecName: Full=Synaptonemal complex protein 2; AltName: Full=Synaptonemal complex central region protein ZYP1b gi|66394508|gb|AAY46120.1| synaptonemal complex central region protein ZYP1b [Arabidopsis thaliana] gi|332192098|gb|AEE30219.1| synaptonemal complex protein 2 [Arabidopsis thaliana] Length = 856 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 642 QELLVKAENNLAEAKKQHDQMLESKQLELSRHLKEISQK 758 +ELL AE LAEAKKQ+D MLESKQLELSRHLKE+SQ+ Sbjct: 520 KELLATAETKLAEAKKQYDLMLESKQLELSRHLKELSQR 558 >ref|NP_173645.3| synaptonemal complex protein 1 [Arabidopsis thaliana] gi|47606316|sp|Q9LME2.1|SYCP1_ARATH RecName: Full=Synaptonemal complex protein 1; AltName: Full=Synaptonemal complex central region protein ZYP1a gi|9392688|gb|AAF87265.1|AC068562_12 T16E15.12 [Arabidopsis thaliana] gi|66394506|gb|AAY46119.1| synaptonemal complex central region protein ZYP1a [Arabidopsis thaliana] gi|332192096|gb|AEE30217.1| synaptonemal complex protein 1 [Arabidopsis thaliana] Length = 871 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 642 QELLVKAENNLAEAKKQHDQMLESKQLELSRHLKEISQK 758 +ELL AE LAEAKKQ+D MLESKQLELSRHLKE+SQ+ Sbjct: 520 KELLATAETKLAEAKKQYDLMLESKQLELSRHLKELSQR 558 >ref|XP_002890507.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. lyrata] gi|297336349|gb|EFH66766.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. lyrata] Length = 871 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 642 QELLVKAENNLAEAKKQHDQMLESKQLELSRHLKEISQK 758 +ELL AE L EAKKQ+D MLESKQLELSRHLKE+SQ+ Sbjct: 520 KELLATAETKLVEAKKQYDLMLESKQLELSRHLKELSQR 558 >ref|XP_003543761.1| PREDICTED: synaptonemal complex protein 1-like [Glycine max] Length = 866 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 648 LLVKAENNLAEAKKQHDQMLESKQLELSRHLKEISQK 758 LL AE+ L+EAKKQ+DQM+E+KQLELSRHLKEISQ+ Sbjct: 525 LLTAAESKLSEAKKQYDQMVENKQLELSRHLKEISQR 561