BLASTX nr result
ID: Cnidium21_contig00016047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016047 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531175.1| conserved hypothetical protein [Ricinus comm... 145 4e-33 ref|XP_002881810.1| predicted protein [Arabidopsis lyrata subsp.... 141 5e-32 ref|NP_001154569.1| uncharacterized protein [Arabidopsis thalian... 141 5e-32 ref|NP_001078039.1| uncharacterized protein [Arabidopsis thalian... 141 5e-32 ref|NP_973663.1| uncharacterized protein [Arabidopsis thaliana] ... 141 5e-32 >ref|XP_002531175.1| conserved hypothetical protein [Ricinus communis] gi|223529245|gb|EEF31218.1| conserved hypothetical protein [Ricinus communis] Length = 158 Score = 145 bits (365), Expect = 4e-33 Identities = 67/76 (88%), Positives = 71/76 (93%) Frame = +3 Query: 54 MGTREVYEEKLRRGNLDYDPTINPGLGNPRCPRCLSLLDPNSENGEWTITSVLHDATAVA 233 MGTREVYEEKLR GNL +DPTINPGLG+PRCPRCLSLL PNS+ GEWTITSVLHDATAVA Sbjct: 1 MGTREVYEEKLRNGNLHHDPTINPGLGSPRCPRCLSLLIPNSDKGEWTITSVLHDATAVA 60 Query: 234 GCGIGGMLSAIHGFNT 281 G GIGGMLSA+HGFNT Sbjct: 61 GSGIGGMLSAVHGFNT 76 >ref|XP_002881810.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297327649|gb|EFH58069.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 158 Score = 141 bits (356), Expect = 5e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +3 Query: 54 MGTREVYEEKLRRGNLDYDPTINPGLGNPRCPRCLSLLDPNSENGEWTITSVLHDATAVA 233 MGTR+VYEEKLRRGNLDYDPT+NPGLG+ RCPRCLSLL+PNSE GEWTIT VLHDA AVA Sbjct: 1 MGTRQVYEEKLRRGNLDYDPTMNPGLGSARCPRCLSLLNPNSEKGEWTITPVLHDAAAVA 60 Query: 234 GCGIGGMLSAIHGFNT 281 G GIGG+LSA+H FNT Sbjct: 61 GSGIGGLLSAVHAFNT 76 >ref|NP_001154569.1| uncharacterized protein [Arabidopsis thaliana] gi|330254960|gb|AEC10054.1| uncharacterized protein [Arabidopsis thaliana] Length = 204 Score = 141 bits (356), Expect = 5e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +3 Query: 54 MGTREVYEEKLRRGNLDYDPTINPGLGNPRCPRCLSLLDPNSENGEWTITSVLHDATAVA 233 MGTR+VYEEKLRRGNLDYDPT+NPGLG+ RCPRCLSLL+PNSE GEWTIT VLHDA AVA Sbjct: 1 MGTRQVYEEKLRRGNLDYDPTMNPGLGSARCPRCLSLLNPNSEKGEWTITPVLHDAAAVA 60 Query: 234 GCGIGGMLSAIHGFNT 281 G GIGG+LSA+H FNT Sbjct: 61 GSGIGGLLSAVHAFNT 76 >ref|NP_001078039.1| uncharacterized protein [Arabidopsis thaliana] gi|330254959|gb|AEC10053.1| uncharacterized protein [Arabidopsis thaliana] Length = 166 Score = 141 bits (356), Expect = 5e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +3 Query: 54 MGTREVYEEKLRRGNLDYDPTINPGLGNPRCPRCLSLLDPNSENGEWTITSVLHDATAVA 233 MGTR+VYEEKLRRGNLDYDPT+NPGLG+ RCPRCLSLL+PNSE GEWTIT VLHDA AVA Sbjct: 1 MGTRQVYEEKLRRGNLDYDPTMNPGLGSARCPRCLSLLNPNSEKGEWTITPVLHDAAAVA 60 Query: 234 GCGIGGMLSAIHGFNT 281 G GIGG+LSA+H FNT Sbjct: 61 GSGIGGLLSAVHAFNT 76 >ref|NP_973663.1| uncharacterized protein [Arabidopsis thaliana] gi|48958503|gb|AAT47804.1| At2g41945 [Arabidopsis thaliana] gi|51536546|gb|AAU05511.1| At2g41945 [Arabidopsis thaliana] gi|330254958|gb|AEC10052.1| uncharacterized protein [Arabidopsis thaliana] Length = 158 Score = 141 bits (356), Expect = 5e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +3 Query: 54 MGTREVYEEKLRRGNLDYDPTINPGLGNPRCPRCLSLLDPNSENGEWTITSVLHDATAVA 233 MGTR+VYEEKLRRGNLDYDPT+NPGLG+ RCPRCLSLL+PNSE GEWTIT VLHDA AVA Sbjct: 1 MGTRQVYEEKLRRGNLDYDPTMNPGLGSARCPRCLSLLNPNSEKGEWTITPVLHDAAAVA 60 Query: 234 GCGIGGMLSAIHGFNT 281 G GIGG+LSA+H FNT Sbjct: 61 GSGIGGLLSAVHAFNT 76