BLASTX nr result
ID: Cnidium21_contig00016021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00016021 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270014.2| PREDICTED: endoplasmin homolog [Vitis vinifera] 69 5e-10 emb|CBI28422.3| unnamed protein product [Vitis vinifera] 69 5e-10 emb|CAN79988.1| hypothetical protein VITISV_021022 [Vitis vinifera] 69 5e-10 ref|XP_002531697.1| heat shock protein, putative [Ricinus commun... 68 9e-10 ref|XP_003519663.1| PREDICTED: heat shock protein 90-like [Glyci... 67 1e-09 >ref|XP_002270014.2| PREDICTED: endoplasmin homolog [Vitis vinifera] Length = 793 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 360 EVLFLVDPIDEVAVTNLKSYNEKDFVDISKEDLDLG 253 EVLFLVDPIDEVA+TNLKSY EK+FVDISKEDLD+G Sbjct: 578 EVLFLVDPIDEVAITNLKSYKEKNFVDISKEDLDIG 613 >emb|CBI28422.3| unnamed protein product [Vitis vinifera] Length = 871 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 360 EVLFLVDPIDEVAVTNLKSYNEKDFVDISKEDLDLG 253 EVLFLVDPIDEVA+TNLKSY EK+FVDISKEDLD+G Sbjct: 656 EVLFLVDPIDEVAITNLKSYKEKNFVDISKEDLDIG 691 >emb|CAN79988.1| hypothetical protein VITISV_021022 [Vitis vinifera] Length = 784 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 360 EVLFLVDPIDEVAVTNLKSYNEKDFVDISKEDLDLG 253 EVLFLVDPIDEVA+TNLKSY EK+FVDISKEDLD+G Sbjct: 569 EVLFLVDPIDEVAITNLKSYKEKNFVDISKEDLDIG 604 >ref|XP_002531697.1| heat shock protein, putative [Ricinus communis] gi|223528673|gb|EEF30688.1| heat shock protein, putative [Ricinus communis] Length = 799 Score = 67.8 bits (164), Expect = 9e-10 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -1 Query: 405 KTFEMIRRLSDSEKHEVLFLVDPIDEVAVTNLKSYNEKDFVDISKEDLDLG 253 K + RL + + EVLFLVDPIDEVAV NLKSY EK+FVDISKEDLDLG Sbjct: 568 KNTPFLERLVEKDL-EVLFLVDPIDEVAVQNLKSYKEKNFVDISKEDLDLG 617 >ref|XP_003519663.1| PREDICTED: heat shock protein 90-like [Glycine max] Length = 791 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 405 KTFEMIRRLSDSEKHEVLFLVDPIDEVAVTNLKSYNEKDFVDISKEDLDLG 253 K + +L++ + EVLFLVDPIDEVA+ NLKSY EK+FVDISKEDLDLG Sbjct: 563 KNTPFLEKLAEKDL-EVLFLVDPIDEVAIQNLKSYKEKNFVDISKEDLDLG 612