BLASTX nr result
ID: Cnidium21_contig00015899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015899 (1226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302586.1| 2-oxoglutarate-dependent dioxygenase [Populu... 67 9e-09 ref|XP_002271841.2| PREDICTED: gibberellin 20 oxidase 1-B-like [... 66 2e-08 ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus co... 65 3e-08 ref|NP_001240043.1| uncharacterized protein LOC100812108 [Glycin... 65 5e-08 ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis... 64 8e-08 >ref|XP_002302586.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] gi|222844312|gb|EEE81859.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] Length = 316 Score = 67.0 bits (162), Expect = 9e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 728 INIPCLSFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 859 +N L+FFWCFEDEK I PNEVVGEG+ R ++PFV +DYLKF Sbjct: 249 VNRLSLAFFWCFEDEKVIMAPNEVVGEGNARIYEPFVCSDYLKF 292 >ref|XP_002271841.2| PREDICTED: gibberellin 20 oxidase 1-B-like [Vitis vinifera] gi|302143842|emb|CBI22703.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 728 INIPCLSFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 859 +N L+FFWCFED+K I PNEVVGEG+ R ++PFV ADYLKF Sbjct: 252 VNRLSLAFFWCFEDDKVIISPNEVVGEGNSRIYQPFVCADYLKF 295 >ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus communis] gi|223550099|gb|EEF51586.1| gibberellin 20-oxidase, putative [Ricinus communis] Length = 318 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 743 LSFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 859 L+FFWCFED+K I PNEVVGEG+LR +KPFV DYL F Sbjct: 254 LAFFWCFEDDKVIFAPNEVVGEGNLRMYKPFVCRDYLNF 292 >ref|NP_001240043.1| uncharacterized protein LOC100812108 [Glycine max] gi|255645239|gb|ACU23117.1| unknown [Glycine max] Length = 319 Score = 64.7 bits (156), Expect = 5e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 743 LSFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 859 LSFFWCFED+K I P+EVVGEG+ R +KPFV DYLKF Sbjct: 255 LSFFWCFEDDKVILAPDEVVGEGNKRKYKPFVCLDYLKF 293 >ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis vinifera] gi|147834194|emb|CAN75307.1| hypothetical protein VITISV_040404 [Vitis vinifera] gi|297745296|emb|CBI40376.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 63.9 bits (154), Expect = 8e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 728 INIPCLSFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 859 +N L+FFWCFEDEK I P+EV+GEG+ R +KPFV DY+KF Sbjct: 251 VNRFSLAFFWCFEDEKVILAPDEVIGEGNTRMYKPFVCLDYVKF 294