BLASTX nr result
ID: Cnidium21_contig00015837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015837 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB69320.1| plastidic 3-deoxy-D-arabino-heptulosonate 7-phosp... 78 8e-13 ref|XP_002513951.1| Phospho-2-dehydro-3-deoxyheptonate aldolase ... 58 9e-07 sp|P27608.1|AROF_TOBAC RecName: Full=Phospho-2-dehydro-3-deoxyhe... 57 2e-06 ref|XP_002301067.1| 2-dehydro-3-deoxyphosphoheptonate aldolase/ ... 56 4e-06 sp|P37822.1|AROG_SOLTU RecName: Full=Phospho-2-dehydro-3-deoxyhe... 55 6e-06 >gb|AAB69320.1| plastidic 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2 [Petroselinum crispum] Length = 547 Score = 77.8 bits (190), Expect = 8e-13 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 3/48 (6%) Frame = +3 Query: 108 MAALTGTNSLVSSKSFQTQNSLA---KSFLVSNVKSIRSIQPISAVHS 242 MAALTGTNSLVSSKSFQTQ+SLA KSFLVSNVKSIRS+QPISAVHS Sbjct: 1 MAALTGTNSLVSSKSFQTQSSLASASKSFLVSNVKSIRSVQPISAVHS 48 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 400 TKQVSTKWNIESWKTKKALQLPEYPDKEELQSVLE 504 TKQVSTKWNIESWKTKKALQLPEYPDKEELQSVLE Sbjct: 86 TKQVSTKWNIESWKTKKALQLPEYPDKEELQSVLE 120 >ref|XP_002513951.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast precursor, putative [Ricinus communis] gi|223547037|gb|EEF48534.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast precursor, putative [Ricinus communis] Length = 535 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 409 VSTKWNIESWKTKKALQLPEYPDKEELQSVLE 504 VS KW+I+SWK+KKALQLPEYP+KEEL+SVL+ Sbjct: 76 VSGKWSIDSWKSKKALQLPEYPNKEELESVLK 107 >sp|P27608.1|AROF_TOBAC RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic; AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1; AltName: Full=DAHP synthase 1; AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase 1; Flags: Precursor gi|170225|gb|AAA34068.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Nicotiana tabacum] gi|228697|prf||1808327A deoxyheptulosonate phosphate synthase Length = 542 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 400 TKQVSTKWNIESWKTKKALQLPEYPDKEELQSVLE 504 T T+W +ESWK+KKALQLPEYP++EELQSVL+ Sbjct: 83 TTVTKTEWTVESWKSKKALQLPEYPNQEELQSVLK 117 >ref|XP_002301067.1| 2-dehydro-3-deoxyphosphoheptonate aldolase/ 3-deoxy-d-arabino-heptulosonate 7-phosphate synthetase [Populus trichocarpa] gi|222842793|gb|EEE80340.1| 2-dehydro-3-deoxyphosphoheptonate aldolase/ 3-deoxy-d-arabino-heptulosonate 7-phosphate synthetase [Populus trichocarpa] Length = 531 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +1 Query: 400 TKQVST-KWNIESWKTKKALQLPEYPDKEELQSVLE 504 T V T KW +ESWK+KKALQLPEYP+KE+L SVLE Sbjct: 68 TTNVGTGKWTVESWKSKKALQLPEYPNKEDLDSVLE 103 >sp|P37822.1|AROG_SOLTU RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic; AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2; AltName: Full=DAHP synthase 2; AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase 2; Flags: Precursor gi|294285|gb|AAA33840.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Solanum tuberosum] gi|445609|prf||1909356A deoxyarabinoheptulosonate phosphate synthase Length = 511 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 29/29 (100%) Frame = +1 Query: 418 KWNIESWKTKKALQLPEYPDKEELQSVLE 504 KW+++SWKTKKALQLPEYPD++EL+SVL+ Sbjct: 61 KWSLDSWKTKKALQLPEYPDEKELESVLK 89