BLASTX nr result
ID: Cnidium21_contig00015394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015394 (593 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 11/86 (12%) Frame = -1 Query: 284 SFMIGQEEATWQNFSQAFIARFDTEP---VFDRFKRLQQVTTVEAYYDEFEKIPS----- 129 S++I + W +F +RF E V + F +LQQ ++E Y DEFEK+ S Sbjct: 84 SYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQTNSLEDYIDEFEKVKSSMLQN 143 Query: 128 ---LTDEYFLENFIGGLHPDIRSMIR 60 L +++ +E+F+GGL P IR +R Sbjct: 144 SYVLPEKHLMESFVGGLKPGIRPFVR 169