BLASTX nr result
ID: Cnidium21_contig00015379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015379 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521646.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002332110.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002521646.1| conserved hypothetical protein [Ricinus communis] gi|223539158|gb|EEF40753.1| conserved hypothetical protein [Ricinus communis] Length = 434 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/70 (40%), Positives = 47/70 (67%) Frame = -2 Query: 329 HYNLAAIQIRTDSPLPTATLRDLDDVLPIHPTDYPQERSFKLFPHSNSFKIFPGTKIISL 150 HYN+ ++I+T +PL A LR LDD + + P++ Q++ F+L PHSNS+ + PG ++I+L Sbjct: 155 HYNIVVVKIQTKAPLTIACLRHLDDSITVDPSEVVQDKPFQLRPHSNSYNLIPGDRVIAL 214 Query: 149 WRTTIPRNCL 120 R + + L Sbjct: 215 GRYFVKPHAL 224 >ref|XP_002332110.1| predicted protein [Populus trichocarpa] gi|222874930|gb|EEF12061.1| predicted protein [Populus trichocarpa] Length = 359 Score = 59.7 bits (143), Expect = 2e-07 Identities = 44/99 (44%), Positives = 55/99 (55%), Gaps = 6/99 (6%) Frame = -2 Query: 329 HYNLAAIQIRTDSPLPTATLRDLDDVLPIHPTD-YPQERSFKLFPH---SNSFKIFPGTK 162 HYNLA IQI TD PLPTA L D+D +P+ PT + F L PH S+ FK+ G K Sbjct: 140 HYNLAIIQITTDYPLPTAILTDIDVSMPLTPTPLLTDSKPFGLRPHTVDSSLFKLRGGDK 199 Query: 161 IISLWRTTIPRNCLNFYSAVFGTTSL--KGGLDFDELYW 51 +I+L R T+ CL S GT S+ GL EL + Sbjct: 200 VIALAR-TLTCQCLLVES---GTLSIYKSSGLHCQELLY 234